KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131425
Entry
3131425           CDS       T01015                                 
Symbol
rpl20, OrsajCp051
Name
(RefSeq) ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131425 (rpl20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131425 (rpl20)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131425 (rpl20)
  Bacteria
    3131425 (rpl20)
SSDB
Motif
Pfam: Ribosomal_L20
Other DBs
NCBI-GeneID: 3131425
NCBI-ProteinID: NP_039409
UniProt: P12139 A0A0K0LQY3
LinkDB
Position
Pltd:complement(66355..66714)
AA seq 119 aa
MTRVPRGYIARRRRAKMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFRRL
WISRINAATRIHKVFDNYSKLIHNLYKKELILNRKILAQVAVLNSNNLYTISNKIKIIN
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaccagagttccgcgaggatatatagctcggagacgacgggcaaaaatgcgttcattt
gcctcaaactttagaggggctcatttaagacttaatcgaatgattactcaacaggtaaga
agagcgtttgtttcctctcatcgagatagagtcaggcaaaagagggattttcggcgtttg
tggatcagtcggataaacgcagcaacgcggatacataaagtattcgataattatagtaaa
ttaatacacaatctttacaagaaagaattgattcttaatcgtaaaatccttgcacaagta
gctgtattaaattcaaataatctttacacgatttccaataaaataaagattatcaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324162
Entry
4324162           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4324162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4324162
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4324162
  Bacteria
    4324162
SSDB
Motif
Pfam: Ribosomal_L20
Other DBs
NCBI-GeneID: 4324162
NCBI-ProteinID: XP_015626192
UniProt: Q942D0 Q7F4A7
LinkDB
Position
1:30608366..30611884
AA seq 122 aa
MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRHNKKRDMRSLWIERINAGTRL
HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRSAFPGNRPPVKKEGLAA
IL
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaacaagggcaagattttcaagttggcaaagggatttagaggcagggcgaaaaattgc
ataaggatagcaagggagagggttgagaaagccttgcaatattcctacagggatagacat
aacaagaagagggatatgcgatccctttggatagagcgtatcaatgctggtacacgattg
catggggtgaactatggaaatttcatgcatggattgatgaaggagaacatccagctcaac
cggaaggtgctctcagagctttctatgcatgagccctacagcttcaaggcacttgttgat
gtatcccgcagtgcatttccagggaacaggccgcctgttaaaaaggagggtctagcagcc
atcctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339398
Entry
4339398           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339398
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339398
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4339398
  Bacteria
    4339398
SSDB
Motif
Pfam: Ribosomal_L20
Other DBs
NCBI-GeneID: 4339398
NCBI-ProteinID: XP_015639823
UniProt: Q0DGJ3 Q65XC7
LinkDB
Position
5:complement(26249567..26251419)
AA seq 121 aa
MNKGKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRI
HGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRTAFPGNRPVKKEGLASI
L
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaacaagggtaaaatttttaagttagcaaaaggattcaggggaagggcaaaaaactgc
ataaggattgctagggagagggtggagaaagcattgcaatactcatacagggatcggcgc
aacaagaagagggacatgcggtctctttggattgagcgcatcaatgctggtacacgaatc
catggggtgaactatggcaatttcatgcatggattgatgaaggagaatatccaactcaac
aggaaggtactttcagagctgtcgatgcatgagccatacagcttcaaagctcttgtcgac
gtctctcgcactgcattccctggaaataggcctgttaagaaggaggggctagcgagtatt
ctttaa

DBGET integrated database retrieval system