KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131427
Entry
3131427           CDS       T01015                                 
Symbol
rpl23, OrsajCp108
Name
(RefSeq) ribosomal protein L23
  KO
K02892  large subunit ribosomal protein L23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131427 (rpl23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131427 (rpl23)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131427 (rpl23)
  Bacteria
    3131427 (rpl23)
  Archaea
    3131427 (rpl23)
SSDB
Motif
Pfam: Ribosomal_L23
Other DBs
NCBI-GeneID: 3131427
NCBI-ProteinID: NP_039462
UniProt: P0C449 P0C451 E9KIS2
LinkDB
Position
Pltd:132154..132435
AA seq 93 aa
MDGIKYAVFTEKSLRLLGKNQYTFNVESGFTKTEIKHWVELFFGVKVVAVNSHRLPGKGR
RMGPILGHTMHYRRMIITLQPGYSIPLLDREKN
NT seq 282 nt   +upstreamnt  +downstreamnt
atggatggaatcaaatacgcagtatttacagaaaaaagtcttcgtttattgggaaagaat
caatatacttttaatgtcgaatcgggattcactaagacagaaataaagcattgggtcgaa
ctcttctttggtgttaaggtagtagctgtgaatagccatcgactacccggaaagggtaga
agaatgggccctattctaggacatacaatgcattacagacgtatgatcattacccttcaa
ccgggttattctattccacttctagatagagaaaaaaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131428
Entry
3131428           CDS       T01015                                 
Symbol
rpl23, OrsajCp071
Name
(RefSeq) ribosomal protein L23
  KO
K02892  large subunit ribosomal protein L23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131428 (rpl23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131428 (rpl23)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131428 (rpl23)
  Bacteria
    3131428 (rpl23)
  Archaea
    3131428 (rpl23)
SSDB
Motif
Pfam: Ribosomal_L23
Other DBs
NCBI-GeneID: 3131428
NCBI-ProteinID: NP_039429
UniProt: P0C449 P0C451 E9KIS2
LinkDB
Position
Pltd:complement(82683..82964)
AA seq 93 aa
MDGIKYAVFTEKSLRLLGKNQYTFNVESGFTKTEIKHWVELFFGVKVVAVNSHRLPGKGR
RMGPILGHTMHYRRMIITLQPGYSIPLLDREKN
NT seq 282 nt   +upstreamnt  +downstreamnt
atggatggaatcaaatacgcagtatttacagaaaaaagtcttcgtttattgggaaagaat
caatatacttttaatgtcgaatcgggattcactaagacagaaataaagcattgggtcgaa
ctcttctttggtgttaaggtagtagctgtgaatagccatcgactacccggaaagggtaga
agaatgggccctattctaggacatacaatgcattacagacgtatgatcattacccttcaa
ccgggttattctattccacttctagatagagaaaaaaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343020
Entry
4343020           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4343020
  KO
K02892  large subunit ribosomal protein L23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343020
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4343020
  Bacteria
    4343020
  Archaea
    4343020
SSDB
Motif
Pfam: Ribosomal_L23
Other DBs
NCBI-GeneID: 4343020
NCBI-ProteinID: XP_015645000
UniProt: Q7EYV4 Q0D6Z9
LinkDB
Position
7:13098587..13103777
AA seq 229 aa
MGSRLGRRVIHFANLPLKLMLPPAPLSSVQEFAVKTVPSASKVDIRRCLESMYGFSVAEV
RTLNMEGKKLRRGPFLAAKPDYKKAYVTLRAPLPVSPDLFPIGLVLGERERKASAAAARR
KAVEGAEVEGEGKGKHWMEDEKVGFSRAGRGKVVYGNPGRLGKKRNGGTKVKDRAGEEVG
KFPWSGTRLATEKKPARKQQYAPKKKGIVLKQKSWKGSVHRQPKKKVEA
NT seq 690 nt   +upstreamnt  +downstreamnt
atggggagccggctgggtcgccgcgtgatccacttcgccaacctccccctcaagctcatg
ctccctcccgcgccgctctcctccgtccaggagttcgccgtcaagaccgtcccctccgcc
tccaaggtcgacatccgccgctgcctcgagtccatgtacggcttctccgtcgccgaggtc
cgcaccctcaacatggagggcaagaagctgcgccggggccccttcctcgccgccaagccc
gactacaagaaggcctacgtcaccctccgcgccccgctccccgtctcccccgacctcttc
cccattgggcttgtcctcggcgagagggagcgcaaggccagcgccgccgccgccaggagg
aaggcggtggagggcgccgaggtggaaggggagggcaaggggaagcactggatggaggat
gagaaggtgggcttctccagggccggccgcggcaaggtggtgtacggcaaccccgggagg
ctggggaagaagaggaatggaggtaccaaggtgaaagacagagccggagaggaagtgggg
aagttcccatggagcgggacgcgtcttgctaccgagaagaaacctgctaggaaacagcag
tatgcccccaagaagaagggcatagtcctgaagcagaagtcatggaagggatccgtgcat
cggcaaccaaagaagaaggtggaagcttag

DBGET integrated database retrieval system