KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131439
Entry
3131439           CDS       T01015                                 
Symbol
rps16, OrsajCp004
Name
(RefSeq) ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131439 (rps16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131439 (rps16)
   03029 Mitochondrial biogenesis [BR:osa03029]
    3131439 (rps16)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131439 (rps16)
  Bacteria
    3131439 (rps16)
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    3131439 (rps16)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 3131439
NCBI-ProteinID: NP_039362
UniProt: P12151 Q8S6G9
LinkDB
Position
Pltd:complement(4487..5553)
AA seq 62 aa
MLKLRLKRCGRKQRFYDPIKNQTCLNVPAILYFLEKGAQPTRTVSDILRKAEFFKEKERT
LS
NT seq 189 nt   +upstreamnt  +downstreamnt
atgttaaaacttcgtttaaaacgatgtggtagaaagcaacgtttttatgatccgataaag
aatcaaacttgtttaaatgttccagctattctctatttccttgaaaaaggtgctcaacct
acaagaaccgtttctgatattttaaggaaggcggaattctttaaagaaaaagaaagaact
ttgagttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346044
Entry
4346044           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4346044
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4346044
   03029 Mitochondrial biogenesis [BR:osa03029]
    4346044
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4346044
  Bacteria
    4346044
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4346044
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 4346044
NCBI-ProteinID: XP_015648554
UniProt: Q84Z89 A3BUV5
LinkDB
Position
8:complement(25702631..25704366)
AA seq 137 aa
MVVRIRLARFGCRNRPFYRLMAADSRSPRDGKHLEVLGYYDPLPGKDGGKRMGLKFDRVK
YWLSVGAQPSDPVERILYRAGILPPPPMLAMAHKGGPRDRRPIDPMTGRPLDLEGVTVVD
DSHTPKSGDGAPNEETA
NT seq 414 nt   +upstreamnt  +downstreamnt
atggttgtccggatcaggctggcgcggttcggctgccggaacaggcccttctaccggctc
atggccgccgacagccgctccccgcgcgacggcaagcacctcgaggtcctcggctactac
gacccgctccccgggaaggatggtggcaagagaatggggttaaaattcgaccgggtgaag
tattggctatcagttggagcacagccatcggatcctgtggagcgcatcctctaccgtgct
ggaattctacctccacctccaatgctagctatggcccacaagggtgggcctcgcgacaga
cgtcctattgatcccatgactgggcgccccttagaccttgagggtgtcacagttgttgat
gattctcatactcccaagagtggtgatggagcacctaacgaggagacagcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347467
Entry
4347467           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347467
   03029 Mitochondrial biogenesis [BR:osa03029]
    4347467
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4347467
  Bacteria
    4347467
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4347467
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 4347467
NCBI-ProteinID: XP_015611901
UniProt: B9G4D6 Q0J0I9
LinkDB
Position
9:19265984..19267675
AA seq 136 aa
MVVRIRLARFGCRNRPFYRVMAADSRSPRDGKHLEVLGYYNPLPGKDGGKRMGLKFDRVK
YWLSVGAQPSDPVQRILFRAGLLPPPPMLAMARKGGPRDRRPIHPMTGRPLDLEGVTVVD
DSNVPEGGAEEPVSEE
NT seq 411 nt   +upstreamnt  +downstreamnt
atggtggtgcggatccggctggcgcggttcggctgccggaaccggccgttctaccgggtg
atggccgccgacagccgctccccgcgcgacggcaagcacctcgaggtcctcggctactac
aacccgctccccgggaaggatggtggcaagaggatggggctgaaattcgacagggtcaag
tactggctgtctgttggtgctcagccatcagatcctgtgcagcgcatcctttttcgagct
gggcttctgcctccacctccaatgctagctatggctcgaaagggtggacctcgtgatagg
cgcccaattcatccgatgactgggcgccccttggatcttgagggtgtcacggttgttgat
gactccaatgttcccgaaggtggtgctgaggaacctgtgtcagaggagtga

DBGET integrated database retrieval system