KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131443
Entry
3131443           CDS       T01015                                 
Symbol
rps3, OrsajCp066
Name
(RefSeq) ribosomal protein S3
  KO
K02982  small subunit ribosomal protein S3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131443 (rps3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131443 (rps3)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    3131443 (rps3)
  Archaea
    3131443 (rps3)
SSDB
Motif
Pfam: Ribosomal_S3_C DUF6100
Other DBs
NCBI-GeneID: 3131443
NCBI-ProteinID: NP_039424
UniProt: P0C483 P0C485 E9KIR8
LinkDB
Position
Pltd:complement(79344..80063)
AA seq 239 aa
MGQKINPLGFRLGTTQNHHSFWFAQPKNYSEGLQEDKKIRNCIKNYIQKNRKKGSNRKIE
ADSSFEVITHNKKMDSGSSSEVITHIEIQKEIDTIHVIIHIGFPNLLKKKGAIEELEKDL
QKEVNSVNQRLNIGIEKVKEPYRQPNILAEYIAFQLKNRVSFRKAMKKAIELTKKTDIKG
VKVKIAGRLAGKEIARAECIKKGRLPLQTIRAKIDYCCYPIRTIYGVLGVKIWIFVDEE
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggacaaaaaataaatccacttggtttcagacttggtacaacccaaaatcaccattcc
ttttggttcgcacaaccaaaaaattattctgaaggtctacaggaagataaaaaaatacgg
aattgtatcaagaactatatacaaaagaataggaaaaagggctcgaatagaaaaatagaa
gcagactcaagtttcgaagtaattacacataataaaaaaatggactcaggctcaagttcc
gaagtaattacacatatagaaattcaaaaagaaatcgatacaatccacgtcataatccat
attggattccccaatttattaaagaaaaaaggagcaatcgaagaattagagaaagatcta
caaaaagaagttaattctgtaaaccagagacttaatattgggatcgaaaaagtgaaagaa
ccttatagacaacctaacattcttgcagaatatatagctttccaattaaaaaatagagtt
tcattccgaaaggcaatgaaaaaagccattgaattaactaaaaaaacagatataaaggga
gtaaaagtaaaaattgcaggccgtctcgcgggaaaagaaattgcgcgtgccgagtgcatc
aaaaaaggtagacttcccctccaaacaattcgcgctaaaattgattattgctgctatcca
attcgaactatctatggagtattaggagttaaaatttggatattcgtagacgaagaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450196
Entry
6450196           CDS       T01015                                 
Symbol
rps3, OrsajM_p18
Name
(RefSeq) ribosomal protein S3
  KO
K02982  small subunit ribosomal protein S3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6450196 (rps3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    6450196 (rps3)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    6450196 (rps3)
  Archaea
    6450196 (rps3)
SSDB
Motif
Pfam: Ribosomal_S3_C VAR1 VirE2 Peptidase_S32
Other DBs
NCBI-GeneID: 6450196
NCBI-ProteinID: YP_002000565
UniProt: P46773 Q7JAJ0
LinkDB
Position
MT:170836..174298
AA seq 538 aa
MARKGNPISVRLDLNRSSDPSRFSDYYYGKSLYQDVNLRSYFSSIRPPTILTFGFRLGRC
IILHFPKRTFIHFFLPRRPLRLKRRDKSRPGKDKGRWWAFGKVGPIGCLHSSEGTEEERN
EVRGRGAGKRVESIDREKQNEIRIWPKKMQRYGYHDRSPSRKKNFSKSLRVSGAFKHPKY
AGVVNDIAFLIENDGPTSHLLKRTLPAVRPSLNYSVMQYFFNTKNKMHFDPVVVLNHFVA
PGVAEPSTMGGAKGGSLDKRIRSRIAFFVESSTSEKKCLARAKKRLIHFIRQANDLRFAG
TTKTTISLFPFFGATFFFPRDGVGVYNNPFFEYAREQLLGQLRIKCRNLMGKDKVMELIE
KFIYLGRIGKLIKGIEMMIEIILRKRIIPYGYNSYLNEVQKMRSFLSNRTNTNTLIESVK
IKSVYQSASLIAQDISFQLGNNPISFRSIFSQIVKDIPLIMPKGVEGIRICCSGRLGGAE
IARTECGKYGKTSCNVFNQKIDYALAEVSTRNGISGVKVRISYSQNKKGRAISETYEI
NT seq 1616 nt   +upstreamnt  +downstreamnt
atggcacgaaaaggaaatccaatttcggtaagacttgatctgaatcgtagttcagatcca
agtcggttcagtgattattattatggtaaatcattgtatcagatgtcaatcttagatctt
atttcagttcgatacgtccacctacgatactcacctttggctttcgtctcggtaggtgta
ttattctacattttcccaaaaggacattcattcatttctttcttccccgtcgaccactac
gactaaaacgacgcgacaaatcaagacccggaaaggataagggccggtggtgggcatttg
ggaaagtcgggccgatcgggtgtcttcattcaagcgagggtacagaggaagaacgaaacg
aagtgagaggccggggggcagggaaaagagtcgagtcgatcgaccgggagaagcaaaacg
aaatcaggatttggccgaaaaagatgcaacgttatggataccatgaccgatcaccatcga
gaaagaagaatttttctaaatcacttcgggtgagcggggccttcaagcatccgaaatacg
ccggggttgtaaatgacatagccttcctgatagaaaatgacggcccgacgagtcatctac
taaaaaggaccctccccgctgtgcgcccctccttgaattattcggtcatgcaatactttt
ttaatacaaagaacaaaatgcatttcgaccccgtcgtagttctcaatcatttcgtggcac
cgggtgtggctgaaccatctacgatggggggagcgaagggaggaagcttagataagagaa
tacgctctcgcatcgctttttttgtagaaagctcgaccagcgagaaaaagtgtttggccc
gagccaaaaagaggttgatccacttcattcgccaagcgaatgatcttcgcttcgcgggaa
caacaaaaaccaccatctcgctctttcctttcttcggtgctacctttttttttccaaggg
atggggttggggtgtataataacccattttttgagtatgcccgggaacaactcctaggtc
aattaaggatcaaatgtaggaacctcatgggtaaggataaggtaatggaattgatagaga
aattcatctacctaggtaggataggcaaattgataaagggaatagagatgatgatagaga
tcatactgagaaagaggataattccgtacgggtacaactcttatttgaacgaagtgcaaa
aaatgcgatcttttttgtctaatagaacaaacactaataccttaattgagtcggtaaaga
tcaaatctgtttatcaaagtgcttctctgattgctcaagacatctcttttcaactgggga
acaatccaatctcatttcgttccatttttagtcaaatagtgaaggatattccattaataa
tgccaaaaggggtggaggggatacgtatttgttgttctggtcgattagggggtgcggaaa
tagctagaactgaatgcggaaagtatggaaaaacatcttgtaatgtatttaaccagaaaa
tcgattatgctcttgcggaagtatccactcgtaacggaatttcaggtgtcaaagtgcgga
tctcatatagtcaaaataagaagggacgtgctatatccgaaacgtacgaaatatag

DBGET integrated database retrieval system