KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131463
Entry
3131463           CDS       T01015                                 
Symbol
rbcL, OrsajCp033
Name
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    3131463 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    3131463 (rbcL)
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     3131463 (rbcL)
SSDB
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Other DBs
NCBI-GeneID: 3131463
NCBI-ProteinID: NP_039391
UniProt: P0C512 A0A0K0LQW8
Structure
LinkDB
Position
Pltd:54095..55528
AA seq 477 aa
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRSACKWSPELAAACEIWKAIKFEFEPVDKLDS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaagtgttggatttaaagctggtgttaaggattat
aaattgacttactacaccccggagtacgaaaccaaggacactgatatcttggcagcattc
cgagtaactcctcagccgggggttccgcccgaagaagcaggggctgcagtagctgccgaa
tcttctactggtacatggacaactgtttggactgatggacttaccagtcttgatcgttac
aaaggccgatgctatcacatcgagcccgttgttggggaggataatcaatatatcgcttat
gtagcttatccattagacctatttgaagagggttctgttactaacatgtttacttccatt
gtgggtaacgtatttggtttcaaagccctacgcgctctacgtctggaggatctgcgaatt
ccccctacttattcaaaaactttccaaggtccgcctcatggtatccaagttgaaagggat
aagttgaacaaatacggtcgtcctttattgggatgtactattaaaccaaaattgggatta
tctgcaaaaaattatggtagagcatgttatgagtgtctacgcggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgttggagggaccgttttgtcttt
tgtgccgaagctatttataaatcacaggccgaaaccggtgaaattaaggggcattacttg
aatgcgactgcaggtacatgcgaagaaatgattaaaagagctgtatttgcgagggaatta
ggggttcctattgtaatgcatgactacttaaccggggggttcaccgcaaatactagtttg
gctcattattgccgcgacaacggcctacttcttcacattcaccgagcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tctgggggagatcatatccacgctggtacagtagtaggtaagttagaaggggaacgcgaa
atgactttaggttttgttgatttattgcgcgatgattttattgaaaaagatcgtgctcgc
ggtatctttttcactcaggactgggtatccatgccaggtgttataccggtggcttcaggg
ggtattcatgtttggcatatgccagctctgaccgaaatctttggagatgattctgtattg
caatttggtggaggaactttaggacatccttggggtaatgcacctggtgcagcagctaat
cgggtggctttagaagcctgtgtacaagctcgtaacgaagggcgcgatcttgctcgtgaa
ggtaatgaaattatccgatcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
atatggaaagcgatcaaattcgagttcgagccggtagataaactagatagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328326
Entry
4328326           CDS       T01015                                 
Name
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4328326
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328326
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4328326
SSDB
Motif
Pfam: RuBisCO_small DUF5768
Other DBs
NCBI-GeneID: 4328326
NCBI-ProteinID: XP_015624320
UniProt: Q67UV8
LinkDB
Position
2:2874947..2876178
AA seq 234 aa
MPMPLPSQVHRCHLLPAPPHSPSLVTLLYSPLLNLFTPPPATTTTLYSGDIMFINTASFV
AGAVVASPEQPAKLVRDQRRVVPGSCRARRGAASNGFRTYCMQTWNPFTNRRYEAMSYLP
PLSAKSISKEIEFIMSKGWVPCLEFDKEGEIHRSNSRMPGYYDGRYWTLWKLPMFGCSDA
AAVLREVEECRREYPDAFIRLIAFDSSRQCQCMSFVVHKPPSAAASPATVAGAE
NT seq 705 nt   +upstreamnt  +downstreamnt
atgcccatgccattgccatcccaagtgcaccggtgccaccttctcccagcgccaccacac
tctccatctcttgtcaccttgctctactctccccttcttaacctcttcacgccaccgccg
gccaccaccaccactctctactccggcgacatcatgttcatcaacacggccagcttcgtc
gccggcgccgtcgtcgcttcgccggagcagccggccaagcttgtccgggatcagaggagg
gtggtgcctggctcctgcagggcaagaagaggtgcagcatccaatggcttcagaacttac
tgcatgcagacatggaaccctttcaccaacaggaggtacgaggcgatgtcttacctgcct
cccctgagcgcgaagtccatctccaaggagatcgagttcatcatgtccaaaggatgggtc
ccttgcctcgagtttgacaaggagggggagatccaccggagcaacagccggatgccgggg
tactacgacgggaggtactggacgctgtggaagctgccgatgttcggatgctctgacgcg
gcggcggtgctccgggaggtggaggaatgccggagggagtacccggacgccttcatccgc
ctcatcgccttcgacagcagccgccagtgccagtgcatgtccttcgtcgtccacaagccg
ccgtcggccgccgcttctccggccacggtcgccggagctgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351966
Entry
4351966           CDS       T01015                                 
Name
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4351966
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4351966
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4351966
SSDB
Motif
Pfam: RuBisCO_small RbcS
Other DBs
NCBI-GeneID: 4351966
NCBI-ProteinID: XP_015619872
UniProt: Q0INY7 A0A345YV67
Structure
LinkDB
Position
12:complement(10080480..10081656)
AA seq 175 aa
MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN
NT seq 528 nt   +upstreamnt  +downstreamnt
atggccccctccgtgatggcgtcgtcggccaccaccgtcgctcccttccaggggctcaag
tccaccgccggcatgcccgtcgcccgccgctccggcaactccagcttcggcaacgtcagc
aatggcggcaggatcaggtgcatgcaggtgtggccgattgagggcatcaagaagttcgag
accctctcctacctgccaccgctcaccgtggaggacctcctgaagcagatcgagtacctg
ctccgttccaagtgggtgccctgcctcgagttcagcaaggtcggattcgtctaccgtgag
aaccacagatcccccggatactacgatggcaggtactggaccatgtggaagctgcccatg
ttcgggtgcactgacgccacccaggtgctcaaggagctcgaggaggccaagaaggcgtac
cctgatgcattcgtccgtatcatcggcttcgacaacgtcaggcaggtgcagctcatcagc
ttcatcgcctacaagcccccgggctgcgaggagtctggtggcaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352014
Entry
4352014           CDS       T01015                                 
Name
(RefSeq) ribulose bisphosphate carboxylase small chain A, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4352014
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4352014
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4352014
SSDB
Motif
Pfam: RuBisCO_small RbcS
Other DBs
NCBI-GeneID: 4352014
NCBI-ProteinID: XP_015619408
UniProt: P18566 G8CTM6
LinkDB
Position
12:11262568..11263639
AA seq 175 aa
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSTNSGFGNVSNGGRIKCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcccccaccgtgatggcctcctcggccacctccgtggctccattccaagggctcaag
tccaccgccgggctccccgtcagccgccgctccaccaactcgggcttcggcaacgtcagc
aatggcggaaggatcaagtgcatgcaggtgtggccaattgagggcatcaagaagttcgag
accctatcgtacctgccaccactcaccgtggaggatcttttgaagcagatcgagtacctg
cttcgatccaagtgggtgccttgcctcgagttcagcaaggttggattcgtctaccgtgag
aaccacaggtctcccgggtactacgatggcaggtattggaccatgtggaagctgcccatg
ttcggctgcaccgatgccacccaggtgctcaaggagctcgaggaggccaagaaggcctac
cccgatgcctttgtccgtatcatcggcttcgacaacgtcaggcaggtgcagttgattagc
ttcatcgcctacaagcccccaggttgcgaggagtctggtggcaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352016
Entry
4352016           CDS       T01015                                 
Name
(RefSeq) ribulose bisphosphate carboxylase small chain A, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4352016
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4352016
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4352016
SSDB
Motif
Pfam: RuBisCO_small RbcS
Other DBs
NCBI-GeneID: 4352016
NCBI-ProteinID: XP_015619409
UniProt: A3CGK1 Q2QTJ7
LinkDB
Position
12:11277142..11278313
AA seq 175 aa
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNSAGLGSVSNGGRISCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcgcccaccgtgatggcctcgtcggccacctccgttgctcccttccaggggctcaaa
tccaccgccgggctccccgtcagccgccgctccaacagcgccggcctcggcagcgtcagc
aacggtggaaggatcagctgtatgcaggtgtggccgattgaaggcatcaagaagtttgag
accctgtcgtacctgccaccgctcacggtcgaggacctcttgaagcagatcgagtacctg
ctccggtccaaatgggtgccttgcctcgagtttagtaaggtcgggttcgtctaccgtgag
aaccacaggtctcctgggtactatgatggcaggtactggaccatgtggaagctgcctatg
ttcggatgcactgatgccacccaggtgctcaaggagctcgaggaggccaagaaggcatat
ccagatgcatttgttcgcatcatcggcttcgacaacgtcaggcaggtgcagttgattagc
ttcatcgcctacaagcccccgggttgcgaggagtccggcggaaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352021
Entry
4352021           CDS       T01015                                 
Name
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4352021
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4352021
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4352021
SSDB
Motif
Pfam: RuBisCO_small RbcS
Other DBs
NCBI-GeneID: 4352021
NCBI-ProteinID: XP_015620270
UniProt: Q2QTJ1 A3CGK3
LinkDB
Position
12:11320272..11321374
AA seq 175 aa
MAPSVMASSATSVAPFQGLKSTAGLPVNRRSSSSSFGNVSNGGRIRCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN
NT seq 528 nt   +upstreamnt  +downstreamnt
atggctccctcggtgatggcttcgtcggccacctccgtggctcccttccaggggctcaag
tccactgcgggcctcccggtgaaccgccgctccagcagctcgagctttggcaacgtcagc
aatggcggaaggatcagatgcatgcaggtgtggccgattgagggcattaagaagttcgag
actctgtcgtacttgccgccattgacagtggaggaccttttgaagcagatcgagtacctg
ctccgatctaagtgggtgccttgcttggagttcagcaaggtcggattcgtctaccgtgag
aatcacagatcacccggatactatgacggtaggtactggaccatgtggaaactgcccatg
tttggatgcaccgatgccacccaagtgctcaaggagctcgaggaggcaaagaaggcatac
cctgatgccttcgttcgcatcattggctttgacaacgttaggcaggtgcagttaatcagc
ttcatcgcgtataagccaccgggttgcgaggagtcaggcggcaactaa

DBGET integrated database retrieval system