KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323835
Entry
4323835           CDS       T01015                                 
Name
(RefSeq) UDP-D-apiose/UDP-D-xylose synthase
  KO
K12449  UDP-apiose/xylose synthase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4323835
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd Sacchrp_dh_NADP Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind UDPG_MGDP_dh_N NAD_binding_10 adh_short
Other DBs
NCBI-GeneID: 4323835
NCBI-ProteinID: XP_015625150
UniProt: Q8S9Z2
LinkDB
Position
1:complement(42738783..42742182)
AA seq 398 aa
MSSSSSPPAASAAARLDLDGNPIAPLTICMIGAGGFIGSHLCEKLMAETAHVVYAVDVYC
DKIRHLVDPAPPHLHGRISFHRLNIKNDSRLEGLIKMADLTINLAAICTPADYNTRPLDT
IYSNFIDALPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPTDHPLRKEPEFYVLKEDESP
CIFGPIVKQRWSYACAKQLIERLIFAEGAENGLEFTIVRPFNWIGPRMDFIPGVDGPSEG
VPRVLACFSNNLLRREPLKLVDGGQSQRTFVYIKDAIEAVHLMIENPARANGQIFNVGNP
NNEVTVRQLAEMMTEVYANVSGEPPLDEPMIDVSSKQFYGEGYDDSDKRIPDMTIINKQL
GWNPKTPLKDLLETTLTYQHKTYKEAIKRQMSQASASS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgtcgccgcccgccgcctccgccgccgcgaggctggatctggacggc
aaccccatcgcgcccctcaccatctgcatgatcggcgccggcggcttcatcggctcccac
ctctgcgagaagctcatggccgagaccgcccacgtcgtctacgccgtcgacgtctactgc
gacaagatccgccacctcgtcgaccccgcccctccccacctccatggccgcatctccttc
caccgcctcaacatcaagaacgactccaggctcgagggcctcatcaagatggccgatctg
acgatcaacctggcggcgatctgcacgccggccgactacaacacgcgccccctcgacacc
atctacagcaacttcatcgacgcgctccctgtggtcaagtactgctctgagaacaacaag
cgtctcatccacttctccacgtgcgaggtctacggcaagaccatcggcagcttcctcccc
accgaccaccctctccgcaaggaacctgaattttatgtactgaaagaagatgaatccccc
tgcatttttggtccaattgtgaaacagcgatggtcttatgcatgtgcgaagcagcttatt
gagaggcttatttttgctgaaggagcagaaaatggccttgagttcacaattgtgagacct
ttcaattggattggaccaagaatggactttattcctggtgttgatggtcctagtgagggt
gttcctcgggttttggcatgtttcagtaacaatctcctgcgtcgggagcccctgaaactt
gttgatggtggccagtcccagagaacttttgtttacattaaggatgccattgaagctgtt
cacttgatgattgaaaatcctgctcgtgccaatggtcaaatcttcaatgtcgggaatcct
aacaatgaagtcactgttaggcaattggctgaaatgatgacagaggtctatgcaaatgtc
tcaggagagccaccactggatgaacctatgattgacgtgagttcgaagcagttctatggt
gaaggatatgatgatagtgataagaggattcctgacatgaccataatcaacaagcagctt
ggttggaatccgaagacccctctcaaggatttgctggagacaacattgacctaccagcac
aagacttacaaagaagctatcaaaaggcaaatgtcacaggcttcagcgtcgagttag

DBGET integrated database retrieval system