KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323838
Entry
4323838           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIA subunit 2-like
  KO
K03123  transcription initiation factor TFIIA small subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4323838
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4323838
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     4323838
SSDB
Motif
Pfam: TFIIA_gamma_N TFIIA_gamma_C
Other DBs
NCBI-GeneID: 4323838
NCBI-ProteinID: XP_015640812
UniProt: Q5JLE4
LinkDB
Position
1:42818985..42821127
AA seq 109 aa
MATFELYRRSTIGMCLTDTLDDMVSSGALSPELAIQVLVQFDKSMTSALEHQVKSKVTVK
GHLHTYRFCDNVWTFILTDAIFKNEEITETINKVKIVACDSKLLETKEE
NT seq 330 nt   +upstreamnt  +downstreamnt
atggccaccttcgagctgtaccggaggtccaccatcggtatgtgcctcaccgacacgctg
gacgacatggtctccagtggggcgctcagccccgagctcgccatccaagtcctcgtgcag
tttgacaagtccatgactagcgctttggagcatcaggtgaagagcaaggttactgtcaag
ggccatctgcacacctacaggttctgcgacaatgtgtggactttcatcctaacagatgca
attttcaagaacgaagagattacagagacaataaacaaggtgaagatcgtggcctgcgat
tccaaattgctggagactaaagaagagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337575
Entry
4337575           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIA subunit 2
  KO
K03123  transcription initiation factor TFIIA small subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4337575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4337575
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     4337575
SSDB
Motif
Pfam: TFIIA_gamma_N TFIIA_gamma_C
Other DBs
NCBI-GeneID: 4337575
NCBI-ProteinID: XP_015640634
UniProt: Q0DLD3 B7EAK7 A0A8J8Y791
LinkDB
Position
5:436979..443270
AA seq 106 aa
MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALENQVKSKVSIK
GHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSKLLSQ
NT seq 321 nt   +upstreamnt  +downstreamnt
atggccaccttcgagctctaccggaggtccaccattggcatgtgcctcactgagacgctc
gacgagatggtctccagcggcaccctcagcccggagctcgccattcaagttcttgtccag
tttgataagtctatgacggaagccttggagaaccaagtcaagagcaaggtttctatcaag
ggccacctgcacacttacaggttctgtgacaatgtatggacattcatcttgactgaagca
tcattcaagaacgaggagactacagaacaagttggcaaggtgaagattgtggcctgtgat
tccaaactactcagccaataa

DBGET integrated database retrieval system