KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323847
Entry
4323847           CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate dehydrogenase [NAD(+)] isoform X1
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4323847
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     4323847
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N GPD_NAD_C_bact DXPR_C
Other DBs
NCBI-GeneID: 4323847
NCBI-ProteinID: XP_015640694
LinkDB
Position
1:complement(42860739..42868197)
AA seq 365 aa
MENGHAKNLVAVIGSGNWGSVASRLIASNTAKLPSFHDEVRMWVFEEILPTGKKLSESIN
QANENCKYLPGIKLGANVIADPDLENAVKDANMLVFVTPHQFVEGICKKLVGKLRPGTEG
ISLIKGMEVKMEGPCMISKLITNILGINCCVLMGANIANEIAVEKFSEATIGYKKDKEVA
TRWAKLFTTPYFLVSVVEDIEGVELCGTLKNVVAIAAGLVDGLDMGNNTKAAIMRIGLRE
MRAFSKLLSPTVRDNTFFESCGVADLITTCLGGRNRRVAEAFARNGGKRSFDELEAEMLH
GQKLQGVSTAKEVYEVLTYRGWQELFPLLSTVHEICIGQLPPTSIVEYSEHTPNLSIING
SNAYY
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggagaacggacacgccaagaatcttgtggccgtcatcggcagcggcaactggggcagc
gtcgcctcccgcctcatcgcttctaacaccgctaagttgccctcctttcatgatgaagta
aggatgtgggtgtttgaagaaatattaccaacaggcaagaagctctctgagtccattaac
caagcaaatgagaattgcaaatacttacctggtataaagctcggagctaatgtaattgct
gatcctgatttggagaatgcagtgaaagatgcaaatatgcttgtttttgtgactccccat
caatttgtggagggtatatgtaagaagcttgtgggtaaactaaggccaggaactgagggt
atctccctcatcaagggcatggaggtcaagatggaaggaccatgcatgatatctaaatta
attacaaacatacttggaatcaattgctgtgtccttatgggtgctaacattgcaaatgag
attgctgttgagaaattcagtgaagcgacaattggatataagaaagacaaggaagtggca
acccgatgggctaaactttttacaacaccttacttcctggtttctgttgtagaggatatt
gaaggagttgaattatgtggaacactgaaaaatgtcgtggccattgcagcaggtcttgtt
gatggtttggatatggggaacaataccaaggctgcaataatgaggattggtttgcgggaa
atgcgtgctttctctaagcttctatcccctacagtcagggacaacactttctttgagagc
tgtggtgtggctgacctaataactacatgccttggtgggagaaacagaagagtcgctgag
gcctttgcacgaaatggtggcaaaaggtcttttgatgagttggaggccgagatgctacat
ggccaaaaacttcagggagtgtccacagcaaaagaagtttatgaagtcttgacttatcga
gggtggcaagaattgtttcctcttctgtccacagtgcatgagatttgtattggtcagcta
cctcctacatcaatagttgaatacagtgagcacacgcccaacctctccatcatcaatggt
tctaatgcgtattactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326512
Entry
4326512           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate dehydrogenase [NAD(+)] 1, cytosolic
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4326512
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     4326512
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N ApbA NAD_binding_8
Other DBs
NCBI-GeneID: 4326512
NCBI-ProteinID: XP_015627070
UniProt: Q8S0G4
LinkDB
Position
1:41245560..41249932
AA seq 456 aa
MVGSVHVNGSVNGGNGTEERLDELRRLLGKSDGDLLKIVGIGAGAWGSVFAALLQDAYGR
FREKVQIRIWRRAGRSVDRTTAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTLYA
DEILRDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVVNGLPSTETREVFEEISKYWKERI
SVPVIISLAKGIEASLDPIPRIITPTQMISSATGVPTENILYLGGPNIASEIYNKEYANA
RICGSNKWRKPLAKFLRQPHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVAALTNESATSK
SVYFAHCTSEMIFITHLLTEQPEKLAGPLLADTYVTLLKGRNAWYGQMLAKGELSPDMGD
SIKGKGMIQGISAVGAFFELLSQPSLSVQHPEENKQVAPAELCPILKRLYRILIKRELST
RDILQALRDETMNDPRERIEMAQSHAFYRPSLLGKP
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggtcgggagcgtgcacgtgaatggatcggtgaacggcggcaatggcaccgaggagagg
ctcgacgagctgcgccgcctgctcggcaagtccgacggcgacttgctgaagatcgtcggc
attggcgccggcgcgtggggcagcgtcttcgccgccctgctgcaggacgcctacggccgt
ttccgggagaaggttcagatacggatatggcgccgggcggggcggtcggtggaccggacc
accgcggagcatctgttcgaggtgatcaactcgagggaggacgtgctgaggcggctcatc
cgccgctgcgcctacctcaagtacgtcgaggcgcgcctcggcgacaggacattgtacgcc
gatgagatactgagggacggcttctgcctgaacatgatcgacacgccactctgccctctc
aaggtggtcaccaacctgcaggaagctgtctgggatgctgacattgtggtgaacggcctt
ccatccaccgagacgagggaggtgttcgaggagatcagcaagtactggaaggagcggatc
agcgttccggtgataatctcgctcgcaaaggggatagaagcatccttggacccaattcct
cgtatcattacgcccacgcagatgattagttctgcaactggagttccaactgagaatata
ctatatcttggaggcccaaacattgcctcagagatttataacaaagaatatgcaaatgct
cgaatctgtgggtccaacaagtggaggaaacctctcgctaagtttctgagacaaccacat
ttcattgtctgggataacagtgatcttgttacacatgaggtgatgggtggtttgaagaat
gtctacgccatcggtgctggaatggttgcagctttaactaatgagagtgcaacaagcaag
tcggtgtattttgctcattgcacgtcagagatgatattcattactcatttgctcacagaa
caacctgagaaacttgctggccctctgctggctgatacttatgttactctcctgaaaggt
cgcaatgcgtggtatgggcaaatgctagcgaagggagaactgagccctgacatgggcgac
agcatcaaggggaaggggatgattcagggtatctctgctgttggtgcattttttgagctt
ctcagtcaacccagcttaagtgtgcaacacccagaggaaaataagcaagttgcacctgct
gaactgtgcccgatcttgaagaggctctatagaatactaataaaaagggagctctcgaca
agagatattctgcaagccctgagagatgaaaccatgaatgatcctcgtgaaaggattgag
atggcgcaaagccatgcattctaccgcccatctctcctaggaaaaccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327964
Entry
4327964           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate dehydrogenase [NAD(+)] 2, cytosolic
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4327964
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     4327964
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 4327964
NCBI-ProteinID: XP_015617993
UniProt: Q8S2G5
LinkDB
Position
1:complement(33952181..33956124)
AA seq 467 aa
MGGAEDAPRAAAANGHGNGATVEEKLDELRRLLGKADGDPLRIVGVGAGAWGSVFCALMQ
DAYGHLRDKVQVRIWRRPGRAVDRATAEHLFEVINAREDVLRRLIRRCAYLKYVEGRLGD
RTLYADEILRDGFCLNMIDTPLCPLKVVTNLQEAVWDADIVINGLPSTDTREVFGEIGRY
WKERITAPIILSLAKGIEASLDPLPRIITPTQMISNATGVPLENILYLGGPNIASEIYNK
EYANARICGADKWRKPLAKFLRQPHFIVWDNSDLITHEVMGGLKNVYAIGAGMVAALTNE
SATSKSVYFALCTSEMIYITHLLEEEPEKLAGPLLADTYVTLLKGRNAWYGQKLAKGELT
LEMGDSIKGKGTIQGVSAVNAFYELLSQDSLSVMHPEANRSVAPVEMCPILKALYKILIK
RELPPDSILQAIRDETMYDPRERIEMAQGHSLYRPSLLGQPKGDAKA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgggcggggcggaggacgcgccgcgcgcggcggcggcgaacgggcacgggaatggggcc
accgtggaggagaagctggacgagctgcggcgcctgctgggcaaggccgacggcgacccg
ctccggatcgtcggcgtcggcgccggggcctgggggagcgtcttctgcgcgctgatgcag
gacgcgtacggacacctccgcgacaaggtgcaggtccgcatctggcgccgcccgggccgc
gccgtcgaccgcgccaccgccgagcacctcttcgaggtcatcaacgcccgggaggacgtc
ctccgccgcctgatccgccgctgcgcctacctcaagtacgtcgagggccgcctcggcgac
cgcaccctctacgccgacgagatactcagggacggcttctgcctcaacatgatcgacacg
ccgctctgcccgctcaaggtcgtcaccaacctccaggaggccgtctgggacgccgacatt
gtcatcaacgggctgccgtccacggacaccagggaagtcttcggggagattgggaggtac
tggaaggagaggattactgcccccatcatcctctctctggccaaagggatagaggcctcc
ctggatcccctgccacggatcataactcccacacagatgattagcaatgcaacgggggtt
ccattggaaaacattctttatcttggaggccctaacattgcttcagaaatttacaataaa
gaatatgcaaatgctcgtatatgtggagctgacaaatggagaaaacctcttgctaaattt
ttgaggcagcctcattttattgtatgggataatagtgatctcattacacatgaagtcatg
ggaggtttgaaaaatgtgtatgccattggtgccggtatggtggcagctctaacaaatgag
agtgcaaccagcaaatccgtttactttgctctttgcacatctgaaatgatttacataacc
caccttttggaagaagagcctgaaaaacttgctgggccattattggctgacacttatgtc
acattgctgaagggtcgtaatgcatggtatgggcagaaactagctaaaggtgaactgaca
ctagagatgggtgacagcataaaaggcaaaggaaccattcagggtgtctctgcagtcaat
gcattttatgaactcctgagtcaggatagcttaagcgtaatgcatcctgaagccaacaga
tctgttgcaccggttgagatgtgcccaatcctgaaggcactgtacaaaattttgatcaag
agggaacttcctcctgattcgatccttcaggccataagagatgaaacaatgtatgatcca
cgtgaaagaattgagatggcgcagggccattcactttaccggccatctcttcttggtcaa
cctaaaggagatgccaaagcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339200
Entry
4339200           CDS       T01015                                 
Name
(RefSeq) probable glycerol-3-phosphate dehydrogenase [NAD(+)] 3, cytosolic
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4339200
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     4339200
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 4339200
NCBI-ProteinID: XP_015637865
UniProt: Q65X70
LinkDB
Position
5:24357901..24361221
AA seq 465 aa
MVGSYAAGGGRGAAVAAVAEGKLDELRRRMGKADGDLLRIVGVGGGAWGSAFCALLQDAY
GRHRDKAQVRVWRRPGRAVDRATAEHLFEVINSREDVLRRLIRRCAYLKYVEARLGDRTL
YADEILRDGFCLNMVDTPLCPLKVVTNLQEAVWDADIVINGLPSTETREVFGEIGRYWKE
RIRPPVIISLAKGIEASIDPVPRIITPTQMISNATGVPLENILYLGGPNIASEIYNKEYA
NARICGADKWRKPLAKFLRQPHFIVWDNSDLITHEVMGGLKNIYAIGAGMVAALTNESAT
SKSVYFSLCTSEMIYITHLLAEDPEKLAGPLLADTYVTLLKGRNAWYGQKLAKGELTLEM
GDSIKGKGTIQGVSAVHAFYELLSQSSLSVTHPEVKKLVAPVELCPILKTLYKILIKREL
ATDSILQAIRDESMYDPRERIEMSQRQCLYRPSLLGLPKVDITQA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggtggggagctacgcggcgggagggggacggggagcggcagtggcggcggtggcggag
gggaagctggacgagctgcggcggaggatggggaaggcggacggcgacctgctgaggatc
gtcggggtggggggcggggcgtgggggagcgccttctgcgcgctgctgcaggacgcgtac
gggcggcaccgcgacaaggcgcaggtgcgggtgtggcggaggcccgggcgcgccgtcgac
cgcgccaccgccgagcacctcttcgaggtcatcaactcccgggaggacgtcctccgcagg
ctcatccgccgctgcgcctacctcaagtacgtcgaggcccgcctcggcgaccgcacgctc
tacgccgacgagatcctccgcgacggcttctgcctcaacatggtcgacacgccgctctgc
ccgctcaaggtcgtcaccaacctgcaggaggcggtctgggacgccgacatagtcatcaac
ggcttgccctccaccgagaccagggaggtgttcggggagatcgggaggtattggaaggag
aggatcagaccccccgtgatcatctcgctggccaaggggatcgaggcgtcgattgacccc
gtgccccggatcattaccccgacacagatgatcagcaatgcaactggagttccattggag
aatattctatatcttggaggtcctaacattgcatctgagatatataacaaagaatatgca
aatgctcgcatatgtggagctgacaagtggagaaaacctctagctaaatttctgaggcag
cctcattttattgtgtgggataatagtgatctcatcactcatgaagtaatgggcggctta
aagaacatatatgccattggtgctggtatggtggctgcactaaccaatgagagtgcaacc
agcaaatcggtttacttttcactttgcacgtctgaaatgatatacatcacccatctccta
gccgaagaccctgagaaacttgccgggcctttattagccgatacctatgtaacactgctg
aaaggtcgtaatgcatggtatgggcagaaattagctaagggtgaactgactcttgaaatg
ggggacagtatcaagggcaaagggactatccagggtgtctctgcagtccatgcattttat
gagctcttgagccagagtagcttaagcgtgacacatccagaagtgaagaagcttgttgct
ccggtcgagctgtgcccaatactaaaaacactttataaaatcctaatcaagagggagctt
gccactgactccattctccaggcaatacgagatgaatcaatgtatgatccacgggagagg
attgagatgtctcagcgccagtgtctttaccgaccatctcttcttggcctacctaaagta
gatattacccaggcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342770
Entry
4342770           CDS       T01015                                 
Name
(RefSeq) glycerol-3-phosphate dehydrogenase [NAD(+)], chloroplastic
  KO
K00006  glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4342770
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     4342770
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N GPD_NAD_C_bact ApbA F420_oxidored Pyr_redox_2 Lycopene_cycl ApbA_C
Other DBs
NCBI-GeneID: 4342770
NCBI-ProteinID: XP_015644859
UniProt: Q8H2J9
LinkDB
Position
7:complement(7229097..7232365)
AA seq 440 aa
MAAAAAATFLPHTPTPRRRLAVAVHSPTRRRLSLVFSGPPDGALSVAAAEEKADAGEEAA
AAVSAPRGGGGGGGKERRRVVRKAWEKLVRWSRSWRRRNRSDVVETTRKVVVLGGGSFGT
AMAAQVAAKKADLEVSMLLRDDLVCRSINHSHINCKYLRDHRLPENITATTSASDALAGA
DFCFHAVPVQFSSSFLEGISTHVDPKLPFISLSKGLELNTLRTMSQIIPQALGNPRQPFI
VLSGPSFAIELMNKLPTAMVVASKDKKLAAAVQQLLASPNLRISTSNDVTGVEIAGALKN
VLAIAAGIVEGMHLGNNCMAALVAQGCSEIRWLATKMGAKPTTLSGLSGSGDIMLTCFVN
LSRNRNVGLRLGSGEKLDEIMNSMNQVAEGVSTAGAVIALAQKYHVKMPVLTAVARIIDN
ELTPKKAVMELMNLPQVEEV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgccaccttcctcccccacacgcccaccccgcgccgccgcctc
gccgtcgctgtccactcaccgacccgccgccgtctctccctcgtgttctccggccctccc
gacggcgccctgtcggtggcggcggcggaggagaaggccgacgccggtgaggaggcggcg
gcggcggtgtcggccccgcggggcggcggaggaggaggagggaaggagcggcgccgcgtg
gtgcggaaagcgtgggagaagctcgtccggtggtcccggtcctggcggcggcgcaaccgg
agcgacgtggtcgagacgacgcgcaaggtggtggtgctcggagggggctcgttcgggacg
gccatggcggcgcaggtggcggccaagaaggccgacctcgaggtctccatgctgctccgg
gacgacctcgtctgccgatccatcaaccacagccacatcaactgtaaatatttacgagac
cacaggttaccagaaaatatcactgcaacaactagtgctagtgatgctttagcaggagca
gatttctgcttccatgctgtcccagttcagttcagttcatcatttctcgagggtatttca
acacatgttgatccgaagttgccgttcatatcgcttagcaaagggcttgaacttaacacc
cttcggacaatgtctcaaatcatccctcaagcgctggggaatccccgccaaccgtttatt
gttctgtcaggaccttcttttgcaatcgaactgatgaacaaattgccaacagctatggtg
gtggcatccaaggacaaaaagttggcagctgctgttcagcagctgttggcctcaccgaat
ttgaggataagcacatcaaatgatgttacaggtgtagaaattgctggcgcacttaagaat
gttcttgcaatagcagcaggtatagtagaaggcatgcatcttggaaataactgtatggcg
gcccttgttgctcaaggctgttcagaaatacgctggttagcaacaaagatgggagcaaag
ccaacaaccctttctggtttatctggctcaggtgacatcatgcttacatgttttgtcaat
ctttcacgaaatagaaatgtgggactgcgtcttggttctggtgaaaaacttgacgaaatc
atgaattctatgaatcaggttgctgaaggtgtatcaactgctggggctgtcatcgcattg
gctcagaagtaccatgtaaaaatgccagtcttgacagcagttgcacggataattgacaat
gaactaaccccaaagaaggctgttatggagttaatgaatcttccacaggttgaggaagta
taa

DBGET integrated database retrieval system