KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323864
Entry
4323864           CDS       T01015                                 
Name
(RefSeq) gibberellin 3-beta-dioxygenase 2-3
  KO
K04124  gibberellin 3beta-dioxygenase [EC:1.14.11.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00928  Gibberellin A4/A1 biosynthesis, GA12/GA53 => GA4/GA1
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4323864
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.15  gibberellin 3beta-dioxygenase
     4323864
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4323864
NCBI-ProteinID: XP_015634638
UniProt: Q9FU53
LinkDB
Position
1:complement(4003156..4005061)
AA seq 373 aa
MPTPSHLKNPLCFDFRAARRVPETHAWPGLDDHPVVDGGGGGGEDAVPVVDVGAGDAAAR
VARAAEQWGAFLLVGHGVPAALLSRVEERVARVFSLPASEKMRAVRGPGEPCGYGSPPIS
SFFSKLMWSEGYTFSPSSLRSELRRLWPKSGDDYLLFCDVMEEFHKEMRRLADELLRLFL
RALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPRRALGLIAHTDSGFFTFVLQSL
VPGLQLFRRGPDRWVAVPAVAGAFVVNVGDLFHILTNGRFHSVYHRAVVNRDRDRVSLGY
FLGPPPDAEVAPLPEAVPAGRSPAYRAVTWPEYMAVRKKAFATGGSALKMVSTDAAAAAD
EHDDVAAAADVHA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgg
gtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggc
ggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgg
gtggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcg
gcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggag
aagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcc
tccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgc
tccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctgtgacgtg
atggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttg
agggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggc
gagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcga
gcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctc
gtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtg
gcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttc
cacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctac
ttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggc
cggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggcc
ttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgac
gaacacgacgacgtcgccgccgccgccgacgtccacgcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337968
Entry
4337968           CDS       T01015                                 
Name
(RefSeq) gibberellin 3-beta-dioxygenase 2-2
  KO
K04124  gibberellin 3beta-dioxygenase [EC:1.14.11.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00928  Gibberellin A4/A1 biosynthesis, GA12/GA53 => GA4/GA1
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4337968
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.15  gibberellin 3beta-dioxygenase
     4337968
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4337968
NCBI-ProteinID: XP_015638886
UniProt: Q6AT12
LinkDB
Position
5:complement(4660620..4662584)
AA seq 384 aa
MQIMTSSSTSPTSPTSPLAAAADNGVAAAYFNFRGAERVPESHVWKGMHEKDTAPVAAAD
ADGGDAVPVVDMSGGDDAAVAAVARAAEEWGGFLLVGHGVTAEALARVEAQAARLFALPA
DDKARGARRPGGGNTGYGVPPYLLRYPKQMWAEGYTFPPPAIRDEFRRVWPDAGDDYHRF
CSAMEEYDSSMRALGERLLAMFFKALGLAGNDAPGGETERKIRETLTSTIHLNMFPRCPD
PDRVVGLAAHTDSGFFTFILQSPVPGLQLLRHRPDRWVTVPGTPGALIVVVGDLFHVLTN
GRFHSVFHRAVVNRERDRISMPYFLGPPADMKVTPLVAAGSPESKAVYQAVTWPEYMAVR
DKLFGTNISALSMIRVAKEEDKES
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgcagatcatgacatcgtcgtcgacctcgccgacctcgccgacctcgccgctggccgcc
gccgccgacaatggcgtcgccgccgcctacttcaacttccgcggggcggagcgcgtgccg
gagtcgcacgtgtggaaggggatgcacgagaaggacaccgcgccggtggcggcggcggac
gcggacggcggcgacgcggtgccggtggtggacatgagcggcggcgacgacgccgcggtg
gcggcggtggcgcgcgcggcggaggagtggggcgggttcctgctcgtcgggcacggcgtg
accgcggaggccctggcgcgcgtcgaggcgcaggcggcgcggctgttcgcgctgccggcg
gacgacaaggcgcgcggggcgcggcggcccggcggcgggaacaccggctacggcgtgccg
ccgtacctcctccggtacccgaagcagatgtgggccgagggctacaccttccctccccct
gccatccgcgacgagttccgccgcgtctggcccgacgccggcgacgactaccaccgcttc
tgctccgccatggaggagtacgactcgtcgatgagagctctgggcgagaggctcctcgcc
atgttcttcaaggcgctcgggctcgccggcaacgatgcccccggcggcgagaccgagcgg
aagatccgcgaaacgttgacgtcgacgattcacctcaacatgttccctaggtgtccagat
ccagaccgggtggtcgggctggcggcgcacacggactcaggcttcttcaccttcatcctg
cagagccccgtgccggggttgcagctgctccgccaccggccggaccggtgggtgacggtt
ccggggacgccgggggcgctcatcgtcgtcgtcggcgatctcttccatgtgctcaccaac
gggcgcttccacagcgtgttccaccgcgccgtcgtgaaccgggagagagaccggatctcc
atgccctacttcctcggtccgccggccgacatgaaggtgacacctctcgtggcggcgggg
tcgccggagagcaaggccgtgtatcaggccgtgacatggccggagtacatggctgtaagg
gataagttgttcgggacaaatatatcggcgttgagcatgattcgagtagcgaaggaagag
gacaaggagagttag

DBGET integrated database retrieval system