KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323876
Entry
4323876           CDS       T01015                                 
Name
(RefSeq) syntaxin-32
  KO
K08490  syntaxin 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4323876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4323876
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    4323876
SSDB
Motif
Pfam: SNARE Syntaxin-5_N Syntaxin Vps5 CREPT DUF16 ArAE_1_C
Other DBs
NCBI-GeneID: 4323876
NCBI-ProteinID: XP_015617756
UniProt: Q0JQ67 Q9LGF8
LinkDB
Position
1:4117929..4122464
AA seq 344 aa
MNPGRPAPASFRDRTNEFRAAVESAARYASSSAAAAPSSSSGGGVGGPLDVSRGAASAHS
EFNRRASKIGLGIHQTSQKLARLAKLAKRTSVFDDPTVEIQELTAVIKKDITALNSAVVD
LQVLCNSQNESGNLSKDTTNHSTTVVDNLKNRLMSATKEFKEVLTMRTENLKVHENRRQM
FSSSAANNASNPFVRQRPLVTRDGPESSVPPAPWASDSATTPLFQRKKTNGDHGASSSSS
QPFMQQQLVQQDSYMQSRAEALQNVESTIHELSNIFTQLATMVSQQGELAIRIDENMDDT
LANVEGAQGQLLKYLNSISSNRWLMMKIFFVLMVFLMIFIFFVA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaacccggggcgcccggcgccggcgtcgttccgcgaccgcaccaacgagttccgcgcc
gccgtcgagagcgccgcgcgctacgcctcctcctccgcggcggcggcgcccagcagcagc
agcggcggcggcgttggcggcccgctcgacgtgtcgcggggggcggcctcggcgcactcg
gagttcaaccgccgcgcctccaagatcgggctcgggatccaccagacctcgcagaagctc
gcccgcctcgccaaactggcaaagaggacatctgtttttgatgaccctacggtagagata
caagagctgactgcagttatcaagaaagatatcactgctttgaattctgccgttgtagac
ctacaggttctctgcaattcacaaaatgagagcggcaacctttccaaggatacaacaaat
cattccactacagttgtggacaatctaaaaaatcgcctgatgagcgcaacaaaagaattt
aaggaagttcttaccatgcggacagagaacttgaaagttcatgagaatagaaggcaaatg
ttctcatcatcagctgcgaacaatgcatcaaatccatttgttcgtcaacgtccccttgtt
accagggatggtcctgaatcctctgtacccccggcaccatgggccagtgattctgccact
actccattgtttcagaggaagaagactaatggagatcatggagcatcatcatcatcttct
cagccattcatgcagcagcagttagtacagcaggacagttacatgcagagtagagcggag
gctctccaaaatgttgaatcaaccatccatgagctaagcaacatttttacacaactggca
actatggtttctcagcagggagagctagcaatcagaattgatgagaacatggatgacaca
ctagccaatgttgagggagctcagggccagctactgaagtatctcaacagcatttcatcg
aaccggtggctgatgatgaagatattctttgtgctgatggttttcctcatgatctttata
ttcttcgttgcatga

DBGET integrated database retrieval system