KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323890
Entry
4323890           CDS       T01015                                 
Name
(RefSeq) phosphoethanolamine N-methyltransferase 1
  KO
K05929  phosphoethanolamine N-methyltransferase [EC:2.1.1.103]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4323890
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.103  phosphoethanolamine N-methyltransferase
     4323890
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran CMAS Methyltransf_PK TehB CheR MTS PCMT Methyltransf_2 MetW Methyltransf_9 Methyltransf_32 RrnaAD PrmA NodS TPMT DOT1 Fibrillarin
Other DBs
NCBI-GeneID: 4323890
NCBI-ProteinID: XP_015622327
UniProt: Q0JK57
LinkDB
Position
1:28739969..28744762
AA seq 499 aa
MDAAAATAVNGVLEVEERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPP
YEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCP
DLMIEDNSIDLIFSNWLLMYLSDEEVEKLVKRMVRWLKVGGYIFFRESCFHQSGDSKRKV
NPTHYREPRFYTKVFKECQALDQDGNSFELSVLTCKCVGAYVKSKKNQNQICWLWQKVDS
TEDRGFQRFLDNVQYKASGILRYERIFGEGFVSTGGIETTKEFVDRLDLKPGQNVLDVGC
GIGGGDFYMADKYDVHVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDV
IYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDV
RAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKA
KLQRSSAGEQRWGLFIATK
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggacgccgcggccgccaccgctgttaatggagtgcttgaggtggaggagaggaaggcg
cagaagagctactgggaggagcactccaaggacctcaccgtcgaggccatgatgctcgac
tcccgcgccgccgatctcgacaaggaggagcgccccgagatattgtctttacttcctcct
tacgaaggaaaatcagtactggaacttggtgctggaataggtcgcttcactggagaacta
gtgaaaacagctgggcatgttcttgcaatggatttcattgaaagtgtgattaagaagaat
gaaagcataaacggtcaccacaagaatgcatcctttatgtgtgcggatgtcacatgtcca
gacctgatgattgaggataactccattgatctgatattttcaaactggttactgatgtat
ctttcagacgaggaggttgagaagctagtaaagagaatggtaagatggctaaaggttggc
ggctatatcttctttagggaatcttgtttccatcagtctggagattcaaaaaggaaagtg
aatcctacacattaccgggagccaaggttttacactaaggtgtttaaagagtgtcaagct
cttgatcaagatgggaattcctttgaactctctgtacttacttgcaagtgtgttggagct
tacgtgaaaagcaagaaaaatcaaaaccagatatgttggctatggcaaaaggttgattca
acagaagatcgggggtttcaaagatttttggacaatgtgcagtacaaagccagtggaata
ttacgctatgaacgcatctttggagaaggctttgtgagcactggtggaattgaaactaca
aaagaatttgtggacaggctggatctcaaacctggccagaacgttcttgatgttggatgt
ggaattgggggcggtgatttttatatggctgacaagtatgatgttcatgttgttggtatt
gatctttcgataaacatggtttcttttgcacttgagcgtgctattgggcgtaagtgctca
gttgagtttgaagtcgctgattgcaccaaaaagacatacccagacaacacgtttgacgtc
atctacagtcgtgatactatccttcacatacaagataaaccctcactatttaaaagtttc
ttcaagtggctcaaacctgggggtaaggtcctaattagtgattactgcaagtgccctggg
aaaccttcagaagagttcgcagcttacattaagcaaaggggttatgaccttcacgacgtc
agggcttacggacagatgcttgagaatgctggtttccatgatgtcattgctgaagaccgc
accgatcagttcctcgatgttctagagagggagcttgctaaagttgaaaagaacaaaaac
gagttcgtctctgatttcagccaggaggactacgacgccattgtgaatggatggaaggca
aaacttcaaaggagttctgctggtgagcagaggtgggggctgttcatcgcgaccaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339516
Entry
4339516           CDS       T01015                                 
Name
(RefSeq) phosphomethylethanolamine N-methyltransferase
  KO
K05929  phosphoethanolamine N-methyltransferase [EC:2.1.1.103]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4339516
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.103  phosphoethanolamine N-methyltransferase
     4339516
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran CMAS Methyltransf_PK CheR TehB MTS PCMT Methyltransf_2 FtsJ MetW RrnaAD NodS Methyltransf_32 Methyltransf_9 Methyltransf_4 TPMT PrmA DOT1 Fibrillarin Met_10
Other DBs
NCBI-GeneID: 4339516
NCBI-ProteinID: XP_015640819
UniProt: B7FA34 A0A8J8YSG5
LinkDB
Position
5:complement(27229411..27233697)
AA seq 495 aa
MDAVAANGIGEVERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGK
SVLELGAGIGRFTGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTI
EDNSIDLIFSNWLLMYLSDEEVEKLVGRMVKWLKVGGHIFFRESCFHQSGDSKRKVNPTH
YREPRFYTKIFKECHSYDKDGGSYELSLETCKCIGAYVKSKKNQNQLCWLWEKVKSTEDR
GFQRFLDNVQYKTTGILRYERVFGEGYVSTGGIETTKEFVDKLDLKPGQKVLDVGCGIGG
GDFYMAENYDAHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSR
DTILHIHDKPALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVKTYG
KMLEDAGFHHVIAEDRTDQFLRVLQRELAEVEKNKEAFMADFTQEDYDDIVNGWNAKLKR
SSAGEQRWGLFIATK
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggacgccgtcgcggcgaatgggatcggggaggtggagaggaaggcgcagcggagctac
tgggaggagcactccaaggacctcaccgtcgaggccatgatgctcgactcccgcgccgcc
gacctcgacaaggaggagcgccccgaggtcctgtctgtactcccttcttacaaagggaaa
tcagtactggagcttggtgctggaataggacgctttactggggaactggcaaaagaagct
ggccatgttttagccctagacttcattgaaagtgtgattaagaagaatgagaacataaat
gggcatcacaagaacataacctttatgtgcgctgatgtcacgtctccggacctgacgatc
gaagataactctattgatctcatattctcaaactggctactaatgtacctttcagatgag
gaggtcgagaagctagtaggaagaatggtgaaatggctgaaggtaggtggccatatattc
tttagggagtcatgctttcaccaatctggagattccaaaaggaaggtgaatccaacacat
taccgggagccaaggttctatacaaagatatttaaagaatgccattcctatgataaagat
gggggttcttatgaactttctctagaaacatgcaagtgcattggggcttatgtgaaaagc
aagaaaaatcaaaatcagttatgttggctatgggaaaaggttaagtcaacagaagacaga
ggattccaaagattcctggacaatgtgcagtacaaaaccactggaatcttacgctatgag
cgtgtcttcggagagggttatgtcagcactggtggaattgaaaccacaaaggaatttgtg
gataagctggatcttaaacctggacagaaagtgcttgatgttgggtgcggaattggaggc
ggcgacttctatatggctgaaaactacgatgcccatgttcttggtattgatctttcaatc
aacatggtttcatttgcaatcgaacgtgccattggacgcaagtgttcggttgagtttgaa
gtagctgattgcaccacaaagacctacgcaccaaatacatttgatgtgatctacagccgt
gacaccattcttcacatacatgataaacctgctttgttcagaagtttcttcaagtggctg
aaacctgggggcaaagtcctcatcagtgattactgtaggaatcctgggaaaccatcagaa
gaatttgctgcttacattaagcagagaggctatgacctccacgatgtgaagacttacgga
aagatgcttgaggatgctggtttccatcatgtcattgctgaagaccgcacggaccagttc
ctgcgtgttcttcaaagggagcttgctgaagttgagaagaacaaagaagccttcatggca
gacttcacccaggaggactacgatgacattgtgaacggctggaacgcgaagctgaagcgg
agctctgccggtgagcagaggtgggggctgttcattgcaaccaaatga

DBGET integrated database retrieval system