KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323904
Entry
4323904           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L29-1
  KO
K02905  large subunit ribosomal protein L29e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4323904
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4323904
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4323904
SSDB
Motif
Pfam: Ribosomal_L29e
Other DBs
NCBI-GeneID: 4323904
NCBI-ProteinID: XP_015621998
UniProt: A0A8J8XHF7 Q9FP55
LinkDB
Position
1:complement(11249629..11251300)
AA seq 60 aa
MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGMDPKFLRNQRYSRKHNKKSGEAESEE
NT seq 183 nt   +upstreamnt  +downstreamnt
atggccaagtcgaagaaccacacggcgcacaaccagtcgtacaaggcgcacaagaacggg
atcaagaagcccaagcgccaccgccagacctccaccaaggggatggacccaaagttcctg
aggaaccagagatattccaggaagcataacaagaagagtggtgaggctgaatccgaggag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338517
Entry
4338517           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L29-1
  KO
K02905  large subunit ribosomal protein L29e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338517
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338517
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4338517
SSDB
Motif
Pfam: Ribosomal_L29e
Other DBs
NCBI-GeneID: 4338517
NCBI-ProteinID: XP_015640189
UniProt: A0A8J8XHF7 Q9FP55
LinkDB
Position
5:complement(16861468..16863000)
AA seq 60 aa
MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGMDPKFLRNQRYSRKHNKKSGEAESEE
NT seq 183 nt   +upstreamnt  +downstreamnt
atggccaagtcgaagaaccacacggcgcacaaccagtcgtacaaggcgcacaagaacggc
atcaagaagcccaagcgccaccgccagacctccaccaaggggatggacccaaagttcctc
aggaaccagaggtactcgaggaagcacaacaagaagagtggtgaggctgaatccgaggag
taa

DBGET integrated database retrieval system