KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323935
Entry
4323935           CDS       T01015                                 
Name
(RefSeq) DNA-damage-repair/toleration protein DRT111, chloroplastic
  KO
K12840  splicing factor 45
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4323935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4323935
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4323935
 Complex B
    4323935
SSDB
Motif
Pfam: G-patch RRM_1 G-patch_2 Rrn6
Other DBs
NCBI-GeneID: 4323935
NCBI-ProteinID: XP_015621433
UniProt: A0A0P0V3H9 Q8L460
LinkDB
Position
1:18847924..18851815
AA seq 368 aa
MLGGLYGDLPPPSSSADDDKPSAAGWSSAAKMAPPTLRKPPATFAPPPSVLRNSRPAPKA
PAAQPPPPPTLPIETTTSTSFQPALVAVQSTVMEEYDPARPNDYEDYRKDKLKRAKEAEV
RKELERRRREEEERERERELREREGRDALNISGEEAWKRRAAMSGSAAPRPSSSPPHGDG
FAIGNSSSSGLGLGAGGQMTAAQRMMARMGWKEGQGLGKQEQGITAPLVAKKTDRRGGVI
VDENSSKQEKKPKSVNFDGPPTRVLLLRNMVGPGEVDDELEEEVASECSKYGTVLRVLIF
EITQADFPAEEAVRIFILFERAEEATKAMIDLEGRFFGGRVVRATFFDEERFGKNQLAPM
PGEVAGFD
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgctgggcggattgtacggcgacctcccgccgccgtcgtcctccgccgacgatgacaag
ccctccgccgccggctggtccagcgccgccaagatggcgccccccaccctccgcaagccc
cccgccaccttcgccccacccccctccgtcctccgaaactcccgccccgcccccaaggcc
cccgccgcacaaccgcctccgccgccgaccctccccatcgaaaccaccacctccacctcc
ttccagcctgcccttgtcgccgtccagtccaccgtgatggaggagtacgacccggccagg
cccaacgactacgaggactacaggaaggacaagctcaagagggccaaggaggccgaggtc
aggaaggagctcgagcggcggcggcgcgaggaggaggagagggagagggagcgtgagctc
agagagagggagggccgcgacgccctgaacatatccggcgaggaggcctggaagaggagg
gccgcaatgagcggctctgccgcgccgaggccgtcctcctctcctccccatggagacggc
ttcgctattgggaactcgtcttcctctgggctgggccttggcgccggcggacagatgacc
gccgcgcagagaatgatggccaggatggggtggaaggaaggccaggggctcggcaagcaa
gaacagggaatcaccgcgcctctagtggctaaaaagactgataggagaggaggagtaatt
gtggacgaaaacagctccaagcaagaaaagaagccaaaatctgtcaactttgatggccct
ccgacacgagttctgctcctccgtaatatggttggtccaggtgaggttgatgatgagctg
gaggaagaagtggcctcagagtgtagcaagtacgggacggtgttgcgcgtgctgatattt
gagatcactcaggcggacttccccgccgaagaggccgtgaggatcttcatactgtttgag
agggcggaagaagcaaccaaggcgatgattgatctggaagggcgcttctttggcgggcgg
gtggtgcgtgccactttctttgatgaggagaggtttgggaagaaccagcttgcccccatg
ccaggtgaagttgccggcttcgactag

DBGET integrated database retrieval system