KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323946
Entry
4323946           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 5
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4323946
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4323946
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4323946
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 4323946
NCBI-ProteinID: XP_015642682
UniProt: Q8LQT7
LinkDB
Position
1:19059220..19061237
AA seq 478 aa
MLLLKAVYRVVVNNFLALAAAAVAAVLLRRPDELAARLRAVSSPLHAATAAVLAAGVARL
VRARRARGVYLVEYGCFRPRPCYRAPFATCLEHAHLMPYLVDEESVAFAIRLLERSGLGD
ETCVPDAYHYMPPDRSLRASRDESELVIFSAVDDVFARSALTPADIDVLIVNCSIFTPTP
VFADMVVNRYKLRAEVQNVNLSGMGCSAGLVSVGLAKNLLQVSPPGTNVLIVSTEILSSQ
YYVGTERAMLLPNCLFRMGAAAMILSNSPDHARFRLGRVVRTVTAARDSDYRCVFQEEDE
QGNTGIRLSKDLATTAGHALKSNIAAFGPLVLPASEQLLVAISFLKRKLKQLSGHAGKVR
LYRPDFRTAFEHFCIHAGGRGVIDEVQHGLGLSDDDVEASRMTLHRFGNTSSSSVLYELA
YLEAKGRMKRGDRVWMISFGAGFDCNSVAWECVKPAPDADGPWVDCIHRYPVQLPEIA
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgctgctcctcaaggccgtgtaccgcgtggtggtgaacaacttcctcgccctcgccgcg
gcggccgtcgcggccgtgctgctccggcgccccgacgagctcgccgcgcggctgcgcgcg
gtgtcgtccccgctgcacgccgccacggcggcggtgctcgcggcgggcgtggcgaggctg
gtgcgcgcgcggcgggcgcggggcgtgtacctggtggagtacgggtgcttccgccccagg
ccgtgctaccgggccccgttcgcgacgtgcctggagcacgcccacctgatgccgtacctg
gtggacgaggagagcgtcgcgttcgccatccggctgctggagcggtcggggctcggcgac
gagacgtgcgtccccgacgcgtaccactacatgccgcccgaccggagcctcagggcgtcg
cgcgacgagtcggagctggtcatcttctccgccgtcgacgacgtgttcgccaggtcggcc
ctgacgcccgccgacatcgacgtgctcatcgtcaactgcagcatcttcaccccgacgccc
gtgttcgccgacatggtcgtcaacaggtacaagctccgcgccgaggtgcagaacgtgaac
ctgtccgggatggggtgcagcgcggggctcgtgtccgtcggcctcgccaagaacctcctg
caggtgtcgcccccgggcaccaacgtgctcatcgtctccacagagatcctgtcgtcgcag
tactacgtcggcacggagcgcgccatgctgctgcccaactgcctcttccgcatgggcgcc
gccgccatgatcctctccaactcgcccgaccacgcgcggttccgcctcggccgcgtggtg
cgcaccgtcaccgcggcgcgggacagcgactaccggtgcgtgttccaggaggaggacgag
cagggcaacacggggatccgcctctccaaggacctcgccaccaccgccggccacgcgctc
aagagcaacatcgccgcgttcggcccgctcgtccttccggcgtccgagcagctgctggta
gccatctccttcctcaagcggaagctcaagcagttgagcggccacgcgggcaaggtgagg
ctgtaccggcccgacttccgcacggcgttcgagcacttctgcatccacgcggggggccgc
ggggtgatcgacgaggtgcagcacgggctcggtctctccgacgacgacgtggaggcgtcg
cggatgacgctgcaccggttcgggaacacgagctccagctcggtgctgtacgagctggcg
tacctggaggccaaggggaggatgaagagaggggatcgggtgtggatgatctccttcggc
gccggcttcgactgcaacagcgtggcgtgggagtgcgtcaagccggcgcccgacgccgac
gggccctgggtcgactgcatccaccgctaccccgtccagctccccgaaatcgcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328676
Entry
4328676           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 11 isoform X1
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4328676
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4328676
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4328676
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C ACP_syn_III Chal_sti_synt_N
Other DBs
NCBI-GeneID: 4328676
NCBI-ProteinID: XP_015626909
UniProt: Q0E2X4 Q6Z6C7
LinkDB
Position
2:complement(5930274..5933125)
AA seq 519 aa
MDNNAEAANDGAGAGERRRLPDFQQSVRLKYVKLGYHYLITNGVYLLLTPLIALVAVHLS
TLTAGDVAGLWSHLRFNLVSVVACTTLLVFLSTVRFLTRPRPVYLVDFACYKPPPERRCS
RDAFMRCSRLAGCFTAASLDFQRRIVERSGLGDDTYLPAAVLREPPNPSMAEARREAEAV
MFGAVDDLLAKTGVSAKEIGVLVVNCSLFNPTPSLSAMVVNHYKLRGNIVSYNLGGMGCS
AGLLAIDLAKDLLQVHRNSYALVISMENITLNWYSGNDRSMLVSNCLFRMGGAAILLSNR
WSERRRSKYELVHTVRTHKGGDDKCFGCVTQEEDGEGNVGVALSKDLMAVAGDALKTNIT
TLGPLVLPLSEQLLFMATLVAKKLLKMKNVKPYIPDFKLAFEHFCVHAGGRAVLDEIEKN
LSLGEWQMEPSRMTLYRFGNTSSSSLWYELAYSEAKGRVRRRDRVWQIAFGSGFKCNSAV
WRALRSVDPEEEALKKNPWMDEIDRFPVVVPRVSRISTD
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacaacaacgccgaggcagcgaatgacggcgccggcgccggcgagcggcggcggctg
ccggacttccagcagtcggtgcggctcaagtacgtgaagctggggtaccactacctcatc
accaacggcgtgtacctcctcctgacgccgctcatcgccctcgtcgccgtccacctctcc
acgctcaccgccggcgacgtcgccggcctctggtcgcacctccgcttcaacctcgtctcc
gtcgtcgcctgcaccaccctcctcgtcttcctctccaccgtccgcttcctcacccgcccg
cgccccgtctacctcgtcgacttcgcctgctacaagccgccgccggagcgccggtgcagc
cgggacgccttcatgcggtgctccaggctcgccggatgcttcaccgccgccagcctcgac
ttccagcgcaggatcgtcgagcgctcgggcctcggcgacgacacctacctccccgccgcc
gtgctccgggagccgcccaacccgagcatggcggaggcgcggcgcgaggccgaggccgtc
atgttcggcgccgtcgacgacctcctcgccaagaccggcgtgagcgccaaggagatcggc
gtcctcgtcgtcaactgcagcctcttcaacccgacgccgtcgctgtccgccatggtggtg
aaccactacaagctccgcggcaacatcgtcagctacaacctcggcggcatgggctgcagc
gccggcctcctcgccatcgatctcgccaaggacctcctccaggtgcaccgaaactcgtac
gcgctcgtcatcagcatggagaacatcacgctcaactggtactccggcaacgaccggtcg
atgctggtgtccaactgcctcttccggatgggcggcgcggcgatcctgctgtcgaacagg
tggtcggagaggcgccggtccaagtacgagctggtgcacacggtgcggacgcacaagggc
ggcgacgacaagtgcttcggttgcgtcacccaggaggaggacggcgagggcaatgtcggc
gtcgcgctgtccaaggacctcatggcggtcgccggcgacgcgctgaagacgaacatcacg
acgctgggtcccctcgtcctgccgctgtcggagcagctcctgttcatggcgacgctggtc
gccaagaagctgctcaagatgaagaacgtcaagccctacatccccgacttcaagctggcg
ttcgagcacttctgcgtgcacgccggcggcagggcggtgctggacgagatcgagaagaac
ttgtcgctgggggagtggcagatggagccgtcacggatgacgctgtacaggtttgggaac
acgtcgagcagctcgctgtggtacgagctggcgtacagcgaggcgaaggggagggtgagg
aggagggacagggtgtggcagatcgcgttcgggtccgggttcaagtgcaacagcgcggtg
tggagggcgctccggtcggtggacccggaggaggaggcgctgaagaagaacccgtggatg
gatgagatcgatcggttccccgtggttgttcccagggtgtccaggatttcaaccgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330627
Entry
4330627           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 6
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4330627
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4330627
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4330627
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 4330627
NCBI-ProteinID: XP_015623542
UniProt: A0A5S6R8J6
LinkDB
Position
2:30500158..30502355
AA seq 485 aa
MTSSSGQLKRLKPLYQLAVNNILAVVAVPLAAAVVLKAAELGHEEILARARALPPAHLFL
AAFVPAAAAVVYLMLRPRAVYMVDYACFRTSPNCRVPFATFLEHSRVWPGFEERSVRFMT
RLLERSGLGEETCLPYAQHYIPPSRDLESSRAEAELIIFSAIDDLLAKTGISPQDIDILV
VNCSLFAPTPSFTDMIINRYKLRKDVRNVHLSGMGCSAGLISVGLARNLLQVAPKGAHAL
VVSTETITPNYYMGQERAMLLPNCLFRMGGAAVLLSTNGAKARFRLARVVRTLTGAQDGA
YHCVYQEEDGRGNVGINLSKDLMSIAGDALKANITTMGPLVLPASEQLLFALSFMARKVL
SGRIKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSSL
WYELAYVEAKGRMRKGDRVWMIGFGSGFKCNSAAWECIRPAANADGPWATCIHRYPVDIP
DVLKH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgacgagctcgtcggggcagctcaagaggctgaagccgctgtaccagctggcggtgaac
aacatcctcgccgtcgtcgccgtgccgctcgcggcggcggtggtgttgaaggcggcggag
ctcgggcacgaggagatcctcgccagggcgcgcgcgctcccgccggcgcacctgttcttg
gccgcgttcgtcccggccgcggcggcggttgtctacctcatgctccgcccccgcgcggtg
tacatggtggactacgcgtgcttccgcaccagccccaactgccgcgtcccgttcgcgacg
ttcctggagcactcccgcgtgtggccgggcttcgaagagcggagcgtccggttcatgacg
cgcctgctcgagcgatcgggcctcggcgaggagacctgcctgccctacgcgcagcactac
atcccgccgtcgcgcgacctcgagtcatcccgcgccgaggccgagctcatcatcttctcc
gccatcgacgacctgctcgccaagaccggcatctccccccaggacatcgacatcctcgtc
gtcaactgcagcctcttcgccccgacgccgtccttcaccgacatgatcatcaaccggtac
aagctccgcaaggacgtgcgcaacgtgcacctctccgggatgggctgcagcgcggggctc
atctcggtgggtctcgccaggaacctgctccaggtcgcgcccaagggcgcgcacgcgctg
gtggtgtccacggagaccatcacgccaaactactacatgggccaggagcgtgccatgctg
ctgcccaactgcctgttccgcatgggcggcgccgccgtgctcctctccaccaacggtgcc
aaggcgcggttccggctggcgcgcgtggtgcggactctgaccggcgcccaggacggtgcg
taccactgcgtgtaccaggaggaggacggccgcggcaacgttgggatcaacctctccaag
gacctgatgagcatcgccggcgacgcgctcaaggccaacatcacgaccatgggcccgctg
gtgctcccggcgtcggagcagctcctcttcgcgctctccttcatggcgcgcaaggtgctg
agcgggcggatcaagccctacatccccgacttccgcacggcgttcgagcacttctgcatc
cacgccggcggccgcgccgtgatcgacgagctgcagcgcagcctcaccctgtcggacgag
caggtggaggcgtcccgcatgacgctccaccggttcggcaacacgtcgagcagctcgctc
tggtacgagctcgcctacgtcgaggccaagggccgcatgcgcaagggcgaccgcgtgtgg
atgatcggcttcggctccggcttcaagtgcaacagcgccgcgtgggagtgcatccgcccc
gccgccaacgccgacgggccatgggccacctgcatccaccgctaccccgtcgacatcccc
gacgtgctcaagcactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331113
Entry
4331113           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 12
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4331113
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4331113
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4331113
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N DUF3022 ACP_syn_III
Other DBs
NCBI-GeneID: 4331113
NCBI-ProteinID: XP_015624780
UniProt: A0A0P0VR33
LinkDB
Position
2:34853774..34855687
AA seq 463 aa
MDLLPLVTLLLLAHAAAWVAWQAAARRRRATCYLLDYACHKPSDDRKVTTELAGAIIERN
KRLGLPEYRFLLKVIVNSGIGEHTYSPRNVLDAREDCPTLRDALDEMDDFFDDAVAAVLA
RAAVSPRDVDLLVINVGSFSPSPSLADRVVRRFGLRDDVMAYNLSGMGCSAGLVSVDLAR
NVMLTRPRTMALVLTSESCAPNWYTGTDKSMMLGNCLFRCGGAAALLTNDPAFRSRAKME
LRCLVRAHIGAHDDAHAAAVHREDADGRLGVSLSKALPKAAVRAFTENLQRLAPRILPAG
ELARFAARLLLRKLLRRKAAAGAAAKINFKTGVDHFCLHPGGTAVIEAVRKSLGLDSYDV
EPARMALHRWGNTSASSLWYVLSYMEAKRRLNAGDRVLMVTFGSGFKCNSSYWVVTKDLA
DAGAWEDCIHDYPPANLVNPYMEKFGWVNDLPSQGQGGAFPFF
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggatttgctgccgctggtgacgctgctgctgctggcgcacgcggcggcgtgggtggcg
tggcaggcggcggcgcggcggcggcgggcgacctgctacctcctcgactacgcgtgccac
aagccctccgacgaccgcaaggtcacgacggagctcgccggcgccatcatcgagcgcaac
aagcgcctcggcctccccgagtaccgcttcctcctcaaggtcatcgtcaactccggcatc
ggcgagcacacctactccccccgcaacgtcctcgacgcccgcgaggactgccccaccctg
cgcgacgccctcgacgagatggacgacttcttcgacgacgccgtcgccgccgtcctcgcc
agggccgccgtctcgccgcgcgacgtcgacctgctcgtcatcaacgtcggctccttctcg
ccctcgccgtcgctcgccgacagggtcgtcaggcggttcgggttgcgggacgacgtcatg
gcgtacaacctctccgggatggggtgcagcgccgggctcgtctccgtcgacctcgcccgc
aacgtcatgctcacgcgcccgcgcaccatggcactcgtcctcacctccgagtcgtgcgcc
cccaactggtacacggggaccgacaagtccatgatgctgggcaactgcctcttccggtgc
ggcggcgccgccgcgctgctcaccaacgacccggcgttccggtcgcgcgccaagatggag
ctccgctgcctcgtgcgcgcgcacatcggcgcccacgacgacgcccacgccgccgccgtg
caccgcgaggacgccgacggccgcctcggggtcagcctcagcaaggcgctcccgaaggcc
gccgtgcgcgccttcaccgagaacctccagcgcctggcgccgcgcatcctccccgccggc
gagctcgcccgcttcgccgcccgcctcctcctccgcaagcttctccgccgcaaggccgcc
gccggcgccgccgccaagatcaacttcaagaccggcgtcgaccacttctgtctccacccc
ggcgggacggcggtgatcgaggcggtgaggaagagcctcgggctggacagctacgacgtg
gagccggcgaggatggcgttgcaccggtgggggaacacgtcggcgagcagcctctggtac
gtgctgtcctacatggaggcgaagcggcggctcaacgccggcgaccgggtgctcatggtg
accttcgggtcggggttcaagtgcaacagcagctactgggtggtgaccaaggacctcgcc
gacgccggcgcctgggaagattgcatccacgactacccgccggcgaacttggtcaaccct
tacatggagaagttcggctgggtcaacgaccttcccagccagggtcagggaggcgcattt
cccttcttttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331714
Entry
4331714           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 11
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4331714
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4331714
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4331714
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 4331714
NCBI-ProteinID: XP_015629925
UniProt: Q8H7Z0 Q10RD8
LinkDB
Position
3:3402616..3407195
AA seq 524 aa
MDSRELLRTVTQAARNHARTLYHRLVGRHLPRILAVTLLLAAARAGGAATTTLDALAREN
ARALVAVAWCCAAAAYAYAMSRPRPVYLVDLAGYKPAASHEATRAESIRRFGLAGDFTGE
SMAFQRRMMERSGLGEATHFPASLFALPVDMCLRTAREESEAVVFGAVDELLAKTGVPPA
DVGVVIVNSSLFSPTPSFTSLVVNRYRLRHDVVTHNLSGMGCSAGIIAIDLAKHLLQVHA
ETYALVVSTENITLNAYMGNYRPMLVTNTLFRMGGAAVLLSNRRAERRRAKYQLMHTVRT
HRGGASDRSYACVTQEEDGAGNVGVSLSKELMSVAGDALRTNITTLGPLVLPLSEQLRFL
ATVVLRRVFGHAAGVKPYLPDFTAALDHFCIHAGGRGVLDELERSLKLSAWHMEPSRMTL
YRFGNTSSSSLWYELSYCEAKGRIRRGDRVWQIAFGSGFKCNSAVWKALRTVDGGAGRDA
GAWAQDIDALPVHVPKVVPIVDDDDGANGGDGDRHDAASHVRPE
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggacagcagggagttgttgaggacggtgacgcaggcggcgcggaaccacgctcggacg
ctgtaccaccgcctcgtcggccgccacctgccgcgcatcctcgccgtcacgctgctgctc
gccgcggcgcgcgccggcggcgccgccacgacgacgctggacgcgctggcgcgggagaac
gcgcgggcgctggtggcggtggcgtggtgctgcgcggcggcggcgtacgcgtacgccatg
tcgcggccgcggccggtgtacctggtggacctcgccgggtacaagccggcggcgtcgcac
gaggcgacgcgcgccgagtccatccgccggttcgggctcgcgggggacttcaccggcgag
agcatggcgttccagcggcggatgatggagcggtcggggctcggcgaggcgacccacttc
ccggcgtcgctgttcgcgctccccgtcgacatgtgcctccgcacggcgagggaggagtcg
gaggccgtcgtcttcggcgccgtcgacgagctgctcgccaagaccggcgtgccgccggcc
gacgtcggcgtcgtcatcgtcaactccagcctcttcagccccacgccgtccttcacctcg
ctcgtcgtgaaccgctaccgcctccgccacgacgtcgtcacccacaacctcagcggcatg
ggctgcagcgccggcatcatcgccattgatctcgccaagcacctccttcaggtgcacgct
gagacgtacgcgttggtggtgagcacggagaacatcacgctgaacgcgtacatgggcaac
taccggccgatgctggtgaccaacacgctgttccggatgggcggcgcggcggtgctcctg
tccaaccggcgcgccgagcggcggcgcgccaagtaccagctgatgcacacggtgcgcacc
caccgcggcggcgccagcgaccggagctacgcgtgcgtgacgcaggaggaggacggcgcc
ggcaacgtcggcgtgtcgctgtccaaggagctcatgtccgtcgccggcgacgcgctgcgc
accaacatcacgacgctgggccccctcgtgctcccgctgtcggagcagctccggttcctc
gccacggtggtgctccgccgcgtgttcggccacgccgccggcgtcaagccctacctcccg
gacttcaccgcggcgctcgaccacttctgcatccacgcggggggccgcggcgtgctggac
gagctggagcggagcctgaagctgagcgcgtggcacatggagccgtcgcggatgacgctc
tacaggttcgggaacacgtcgagcagctcgctgtggtacgagctgtcctactgcgaggcg
aaagggaggatcaggcgcggcgaccgggtgtggcagatcgcgttcggctccggattcaag
tgcaacagcgccgtctggaaggcgctcaggacggtcgacggcggcgccggccgggacgcc
ggcgcgtgggcgcaggacatcgacgcgctgccggtgcacgtgcccaaggtggtgcccatc
gtcgacgacgacgacggcgccaatggcggcgacggcgaccgacacgacgcggcgtcgcac
gtacgaccggaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331836
Entry
4331836           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 10
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4331836
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4331836
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4331836
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C ACP_syn_III Chal_sti_synt_N
Other DBs
NCBI-GeneID: 4331836
NCBI-ProteinID: XP_015632380
UniProt: Q10QW1 Q0DUK4
LinkDB
Position
3:4266960..4271830
AA seq 542 aa
MAREQALLLTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISHG
VYLATIPVIVLVCGAEVGSLSRDELWRKVWGEATYDLATVLAFLAVLAFTISVYIMSRPR
PVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESYMPRCV
FEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSLSAMIV
NHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYAGKRRS
MLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDEQRIKG
LSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPPSADGD
ASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNTSSSSI
WYELAYLEAKGRVRRGDRVWQLAFGSGFKCNSAVWRAVRRVRRPARSPWLDCVEQYPARM
NA
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcgagggagcaggcgctgctgttgacggagatcgtgaaccgcggcgtggagccgtcg
gggccggacgccgggtcgccgacgttctcggtgcgggtgcggcggcggctgccggacttc
ctccagtcggtgaacctcaagtacgtgcggctcgggtaccactacctcatcagccacggc
gtgtacctggccaccatcccggtcatcgtgctcgtctgcggcgccgaggtcggcagcctc
agccgagacgagctgtggcgcaaggtctggggcgaggccacctacgacctcgccaccgtc
ctcgccttcctcgccgtcctcgccttcaccatctccgtctacatcatgtccaggcctagg
cccgtctacctcatcgacttcgcctgctacaaaccagccgacgaactcaaggtgtcgaag
gcggagttcatcgatctggcgaggaagtcgggcaagttcgacgaggatagcctggcgttc
cagtcgcggctgctggccaagtctggcatcggcgacgagtcctacatgccgcgctgcgtg
ttcgagccgggcaccaactgcgccaccatgaaggaaggccgcgccgaggcgtccgccgcc
atgttcgccgcgctggacgagctgttcgacaagtgccgcgtccgccccaaggacgtcggc
gtgctcgtcgtcaactgcagcctcttcaacccgacgccgtcgctgtccgccatgatcgtc
aaccactacaagatgcgcgggaacatcctcagctacaacctcggcggcatggggtgcagc
gccggcgtcatcgcggtggacctcgcccgcgacatgctccaggccagcggcgcggggctc
gccgtcgtcgtcagcacggaggccgtctccttcacctggtacgccgggaagcgccgctcc
atgctcatccccaacgccttcttccgcgccggctgcgccgccgtgctgctctccaaccgc
cgcagggacttccaccgcgccaagtaccagctcgagcacatcgtgcgcacccacaagggc
gccgacgaccgcagcttccggtcggtgtaccaggaggaggacgagcagcggatcaagggc
ctgtccatcagccgcgacctcgtggaggtcggcggccacgcgctcaagaccaacatcacc
accctgggcccgctcgtgcttccgttctcggagcagatcctcttcttcgccggcgtgctc
ttccgccacctgttcccgtccaagacctccgccccgccgccgccgtccgccgacggcgac
gcctccgccgccgctccctacatcccggacttcaagcgcgcgttcgagcacttctgcatg
cacgcggcgagccgcgacgtgctggagcacctgcagggcaacctgggcctccgcgacggc
gacctggaggcgtcgcgcgccgcgctccaccgcttcggcaacacgtcgagcagcagcatc
tggtacgagctggcgtacctggaggccaagggccgcgtccgccgcggcgaccgcgtgtgg
cagctcgccttcggctccgggttcaagtgcaacagcgccgtgtggcgcgccgtccgccgc
gtgcgccgcccggcgcgcagcccgtggctggactgcgtcgagcagtacccggctcgcatg
aacgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332090
Entry
4332090           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 6
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4332090
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4332090
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4332090
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 4332090
NCBI-ProteinID: XP_015632982
UniProt: Q10PV5 A0A8J8Y199
LinkDB
Position
3:complement(6302798..6304923)
AA seq 494 aa
MPGAAGYSGSVKLKYVKLGYQYLVNHFLTLLLVPVMAATALELARMGPGELLSLWRSLQL
DLVHILCSVFLVVFVGTVYFMSRPRPVYLVDYSCYKPPPSCRVPFATFMEHTRLITDDEK
SVRFQTRILERSGLGEETCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPK
DIDILVVNCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHP
NSNALVVSTEIITPNFYWGTRRDMMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVVRT
HKGADDRAYRCVYEEEDEQGHSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFF
RLVGRKLINKKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLHRF
GNTSSSSLWYELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPADGPWDDC
IHRYPVDIPEVVKL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgccgggggcggcggggtactccgggtcggtgaagctgaagtacgtgaagctggggtac
cagtatctggtgaaccacttcctgacgctgctgctggtgccggtgatggcggcgacggcg
ctggagctggcgcggatggggcccggtgagctgctgtcgctgtggcggtcgctgcagctc
gacctcgtccacatcctctgctcggtgttcctcgtcgtgttcgtcggcacggtgtacttc
atgtcgcggccaaggccggtgtacctcgtcgactactcctgctacaagccgccgcccagc
tgccgggtgccgttcgccacgttcatggagcacacgcgcctcatcaccgacgacgagaag
agcgtgcggttccagaccaggatcctcgagcggtcggggctcggggaggagacctgcctc
ccgccggccaaccactacatcccgcctaacccgtccatggaggcgtcgcgcgccgaggcc
cagctcgtaatcttctccgccatcgacgacctcgtccgccgcaccggactcaagcccaag
gacatcgacatcctcgtcgtcaactgcagtctcttctccccgacaccgtcgctctccgcc
atgatcatcaacaagtacaagctccgcagcaacatccgcagcttcaacctgtccggcatg
ggctgcagcgccggcctcatctccctcgacctcgcccgcgacatgctccaggtgcatccc
aactcgaacgcgctggtggtgtcgacggagatcatcacaccaaacttctactggggaacc
cggcgggacatgatgctgcccaactgcctgttccggatgggcgcggcggcgatcctgctg
tcgaacaggaggagggaggcgaggagggccaagtacaggctgatgcacgtggtccgcacg
cacaagggcgccgacgaccgcgcgtaccggtgcgtgtacgaggaggaggacgagcagggg
cactcggggatctcgctgtccaaggagctgatggccatcgccggcgacgcgctcaagtcg
aacatcaccaccatcggcccgctggtgctgcccatgtcggagcagctgctcttcttcttc
cgcctcgtcggccgcaagctcatcaacaagaagtggaagccgtacatcccggacttcaag
ctggcgttcgagcacttctgcatccacgccgggggacgcgccgtgatcgacgagctgcag
aagaacctggacctgtccgcgcagcacgtggaggcgtcccgcatgacgctgcaccggttc
ggcaacacgtcgagcagctcgctctggtacgagctcgcctacatcgaggccaaggggcgc
atgcgccgcggcgaccgcgtctggcagatcggcttcggcagcggattcaagtgcaacagc
gccgtctggaagtgcctccgcacagtcaagacgcccgccgacgggccgtgggacgactgc
atccaccgctaccccgtcgacatcccggaggtcgtcaagctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332236
Entry
4332236           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 1
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4332236
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4332236
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4332236
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 4332236
NCBI-ProteinID: XP_015627774
UniProt: A0A8J8XVS8 Q10P61
LinkDB
Position
3:complement(7686724..7695593)
AA seq 532 aa
MEAAVMERERLTAEMAFRDDARAAGGEWAPSIVIKIRRRLPDFARSVNLKYVKLGIRHGG
SVTSYLPMLCVPLLASAAYSFVRLDVIYRSIDLLTCVAWLGTAVLLLTVYYFKRPRPVYL
VEFACYKPDDQHKISKEGFLEMTESTGCFNDAALDFQTKITNRSALGDETYLPPGVQARP
PRLNMAEARMEAEAVMFGCLDALFESTGINPKRDVGILIVNCSLFNPTPSLSSMIINHYE
MRADVKSFNLGGMGCSAGLIAIDLAKDMLQANPNSYAVVLSTENITLNWYFGNDRSMLLS
NCIFRMGGAAALLSNRRADAGRAKYRLLHTVRTHKGATDECFNCVYQREDEDGKVGVSLA
RELMAVAGDALKTNITTLGPLVLPLTEQLKFLKSLMMRRVFRVKGVRPYIPDFRRAFEHF
CVHAGGRAVLEEVQRSLSLEDRDMEPSKCSLHRFGNTSSSSLWYELAYAEAKGRVQRGNR
VWQIGFGSGFKCNSAVWRALRDVPAVSPPPKGKKSCNPWVDCVAKYPPKAYV
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaggcggctgtcatggagcgggagcggctcacggcggagatggcgttccgcgacgac
gcgcgggcggccgggggggagtgggcgccgagcatcgtgatcaagatccggcgccgcctc
ccggacttcgcgcggtccgtgaacctcaagtacgtcaagctcgggatccggcacggcggc
agcgtcacgtcgtacctgcccatgctgtgcgtgccgctgctcgcctccgccgcctactcc
ttcgtccgcctcgacgtcatctaccgctccatcgacctgctcacctgcgtcgcctggctc
gggaccgccgtgctgctgctcaccgtctactacttcaagcgcccgcgcccggtgtacctc
gtcgagttcgcctgctacaagccggacgaccagcacaagatctccaaggaaggcttcctc
gagatgaccgagagcaccggctgcttcaatgacgccgcgctcgacttccagaccaagatc
accaatcgctccgcgctcggcgacgagacgtacctccctcccggcgtccaggcgcggccg
ccgaggctcaacatggccgaggcgaggatggaggccgaggccgtcatgttcgggtgcctc
gacgcgctcttcgagtccaccgggatcaacccgaaacgcgacgtgggcatcctcatcgtc
aactgcagcctcttcaacccgacgccgtcgctgtcgtcgatgatcatcaaccactacgag
atgcgggcggacgtcaagtcgttcaacctcggcggcatggggtgcagcgccggcctcatc
gccatcgacctcgccaaggacatgctccaggcgaaccccaactcgtacgcggtcgtcctc
agcacggagaacatcaccctcaactggtacttcggtaacgaccgctcgatgctcctttcg
aattgcatcttccgtatgggcggcgcggcggcgctgctctcgaaccgccgcgccgacgcc
ggccgcgccaagtaccggttgctgcacaccgtgcggacgcacaagggcgccaccgacgag
tgcttcaactgcgtgtaccagcgcgaggacgaggacgggaaggtcggggtgtcgctggcg
cgggagctcatggcggtggccggcgacgcgctcaagaccaacatcaccacgctggggccc
ctcgtcctcccgctcaccgagcagctcaagttcctcaagtccctgatgatgcgccgcgtg
ttccgcgtcaagggcgtgcgcccctacatcccggacttccgccgcgcgttcgagcacttc
tgcgtgcacgccggcggccgcgccgtgctggaggaggtgcagcgcagcctcagcctggag
gacagggacatggagccgagcaagtgctcgctgcaccggttcggcaacaccagcagcagc
tcgctgtggtacgagctggcgtacgccgaggccaagggccgcgtccagcgcggcaaccgc
gtgtggcagatcggcttcggctcggggttcaagtgcaacagcgcggtctggcgcgcgctc
cgcgacgtgccggccgtgtcgccgccgccgaaggggaagaagagctgcaacccctgggtg
gactgcgtcgccaagtacccgcccaaggcgtacgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332981
Entry
4332981           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 12
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4332981
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4332981
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4332981
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C Chal_sti_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 4332981
NCBI-ProteinID: XP_015629305
UniProt: A0A0P0VYT0 Q75M74
LinkDB
Position
3:15149931..15151943
AA seq 467 aa
MELLALVTVLLLAHAVAYLAWTAAARRRQSRCYLLDYVCHKPSDDRKVSTEAAGAVIERS
KRLSLPEYRFLLRVIVRSGIGEETYAPRNVLDGREGEPTHGDSLGEMEDFFGDSIAELFA
RTGFGPRDVDVLVVNASMFSPDPSLASMIVHRYGMREDVAAYSLAGMGCSAGLISLDLAR
NTLATRPRALALVVSTESIAPNWYTGTDKSMMLANCLFRCGGASVLVTNDPVLRGRAKME
LGCLVRANIAANDDAHACALQREDDDGTVGISLSKALPKAAVRAFAANLRRLAPRILPIT
ELARFAAQLLITKKLLRRRATAATATKHTGGDGPRINFKTGVDHFCLHPGGTAVIEAVKR
SLGLDDDDVEPARMTLHRWGNTSASSLWYVLSYMEAKGRLRRGDKVLMVTFGSGFKCNSC
VWEVTGDMADKGAWADCIDAYPPENTANPYMEKYSWINDVDGDSLII
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggagctgcttgccttggtcaccgtgctcctcctggcgcacgccgtggcgtacctcgcg
tggacggcggcggcgcggcggcggcagtcgcggtgctacctcctcgactacgtgtgccac
aagccgtccgacgaccgcaaggtgagcacggaggcggccggcgcggtgatcgagcggagc
aagcggctcagcctgccggagtacaggttcctcctccgcgtcatcgtccgctccggcatc
ggcgaggagacgtacgcgccgcggaacgtgctcgacggccgggagggcgagcccacgcac
ggggactcgctcggcgagatggaggacttcttcggcgactccatcgccgagctcttcgcc
aggacggggttcggcccgcgcgacgtcgacgtgctcgtcgtcaacgcctccatgttctcg
ccggacccgtcgctggcgtccatgatcgtgcaccgctacggcatgcgcgaggacgtcgcc
gcctacagcctcgccgggatggggtgcagcgcggggctgatctcgctggacctggcgcgg
aacacgctggcgacgcggccgcgcgcgctggcgctcgtcgtgtccacggagtccatcgcg
cccaactggtacaccggcaccgacaagtccatgatgctggctaactgcctgttccgctgc
ggcggcgcctccgtgctggtcaccaacgacccggtgctccgcgggcgcgccaagatggag
ctcggctgcctcgtgcgcgccaacatcgccgccaacgacgacgcccacgcctgcgcgctg
cagcgggaggacgacgacggcaccgtcgggatcagcctcagcaaggcgctccccaaggcc
gccgtccgcgccttcgccgccaacctccgccgcctcgccccgcgcatcctccccatcacc
gagctcgcccgcttcgccgcccagctgctcatcaccaagaagctcctccgccgccgcgcc
accgccgccaccgccaccaagcacaccggcggcgacgggcccaggatcaacttcaagacg
ggcgtggaccacttctgcctccaccccggcggcacggccgtgatcgaggccgtgaagcgc
agcctgggcctcgacgacgacgacgtggagccggcgaggatgacgctgcaccggtggggg
aacacgtcggcgagcagcctgtggtacgtgctgtcgtacatggaggcgaaggggaggctg
aggcggggcgacaaggtgctgatggtgacgttcgggtcggggttcaagtgcaacagctgc
gtgtgggaggtgaccggcgacatggccgacaagggcgcgtgggccgactgcatcgacgcc
tacccgccggagaacacggccaacccctacatggagaagtattcgtggatcaacgacgtc
gacggagacagcctcatcatctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332986
Entry
4332986           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA synthase 19
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04626  Plant-pathogen interaction
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4332986
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4332986
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     4332986
SSDB
Motif
Pfam: FAE1_CUT1_RppA ACP_syn_III_C Chal_sti_synt_C ACP_syn_III Chal_sti_synt_N
Other DBs
NCBI-GeneID: 4332986
NCBI-ProteinID: XP_015630137
UniProt: Q10KI1 Q0DRH8
LinkDB
Position
3:15208680..15211412
AA seq 472 aa
MHANTMELTPLLAVVLLLPPALAVAHMAWTAASRRRHTRCYLLDYVCYKPEDDRTLTAEL
AGEIVQRNERLGMAEFRFLLRLISRAGLGDRTYVPRNLLDGREELAAGQLHAVDEMDACF
DGAVPELLARTGLRARDVDVLVVNVSGFFPEPCLASRVVRRYGMREDVAAYNLSGMGCSA
TLVAVDVARNAMRARSPRPVMALVVSTESLAPHWYAGKDRTMMLGQCLFRCGGAAVLLSS
DPAHRGRAKMELRRLVRSTTAASDDAYSCIMQREDDDGLRGVSISKALPKAALRAFAANL
QRLLPRVLPAMEIARLAADLAWQNLLQRRRHRGQTKLKINLKAGVDHICLHAGGVAVIDA
VKKSFGLEERDVEPSRMTLHRWGNTSASSVWYVLSYMEAKGRLRRGDKVLMVTFGSGFKC
NSCVWEVTGDMADKGAWADCIDAYPPESKPSPFLEKFAWVNDEVADESSSPF
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcatgcgaacacgatggagctcacgcctttgctcgccgtcgtgctcctcctgccgccg
gcgctcgcggtggcgcacatggcatggacggccgcctcccgccgccgccacacgcggtgc
tacctcttggactacgtctgctacaagccggaggatgaccgcacgctgacggcggagctc
gccggcgagattgtccagcgcaacgagcggctcgggatggcggagttccgcttcctcctc
cgcctcatctcccgcgcgggacttggcgaccggacctacgtgccgcggaacctcctcgac
ggccgcgaggagctcgccgcggggcagcttcacgcggtcgacgagatggacgcctgcttc
gacggcgccgttccggagctcctcgccaggacggggctccgcgcccgcgacgttgacgtg
ctcgtcgtcaacgtcagcggcttcttcccggagccctgcctcgcgtccagggtggtgcgc
cggtacggcatgcgcgaggacgtcgcggcgtacaacctctccgggatggggtgcagcgcc
acgctggtcgcggtggacgtcgcccggaacgccatgcgcgcgcggtcgccgcggcccgtg
atggcgctggtggtctcgacggagtcgctggcgccgcactggtacgccgggaaggacagg
accatgatgctggggcagtgcctcttccggtgcggcggggcggccgtgctgctcagcagc
gacccggcccaccgcggccgcgccaagatggagctccgccgccttgtgcgctccaccacc
gcggccagcgacgacgcctactcctgcatcatgcagcgcgaggacgacgatggcctccgc
ggggtcagcatcagcaaggccctccccaaggccgcgctccgcgcgttcgccgccaacctg
cagcgcctcctgccgcgcgtcctcccggccatggagatcgcccggctcgccgccgacctg
gcatggcagaatctgttgcagcgccgccgccaccgagggcagaccaagctgaagatcaac
ctcaaggcaggggtggaccacatctgcctccacgccggcggggtggcggtgatcgacgcg
gtgaagaagagtttcgggctggaggagcgagacgtcgagccgtcgaggatgacgttgcac
aggtgggggaacacgtcggcgagcagcgtgtggtacgtgctgtcgtacatggaggcgaag
gggaggttgaggcgaggcgacaaggtgctgatggtgacgttcgggtcggggttcaagtgc
aacagctgcgtgtgggaggtgaccggcgacatggccgacaagggcgcgtgggccgactgc
atcgacgcgtacccaccggagagcaagcccagcccgttcttggagaagttcgcttgggtc
aacgatgaagtcgccgatgaatcctcctcgccgttctag

DBGET integrated database retrieval system