KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323991
Entry
4323991           CDS       T01015                                 
Name
(RefSeq) probable ribosome biogenesis protein RLP24
  KO
K02896  large subunit ribosomal protein L24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4323991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4323991
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4323991
  Archaea
    4323991
SSDB
Motif
Pfam: Ribosomal_L24e zf-FCS
Other DBs
NCBI-GeneID: 4323991
NCBI-ProteinID: XP_015622111
UniProt: A0A0P0V392
LinkDB
Position
1:complement(18158749..18163576)
AA seq 164 aa
MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRCLHG
KDMTQDSTFEFERKRNRPERYDRNVTAQTLKAIPLITKIRHERHKKHITERQKQGKTKQR
ERDAKELEQDIQMLPKKDTMLSTQKTKVVVKVSQQQTEENLMEE
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaggttggagaagtgctggttctgctcctccaccatctaccccggccacggcatccag
ttcgtccgcaacgacgccaagatcttccgcttttgccggtcaaaatgccataaaaatttt
aagatgaagaggaatcctcgtaaggttaaatggacaaaagcatacagatgcttgcatggg
aaggacatgacgcaggactccacctttgagtttgagaggaagaggaacagaccagagcgc
tatgaccggaatgtcactgcacaaactcttaaggctatccctcttattacaaagattaga
catgaacgccataaaaaacatattacagagaggcaaaaacagggtaagacaaagcaaagg
gagagagatgctaaggagttggaacaggatattcaaatgctcccgaagaaggataccatg
ctgtcaacacaaaagacaaaggtcgtggtcaaagtttctcagcagcagaccgaagaaaat
cttatggaagagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327483
Entry
4327483           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L24
  KO
K02896  large subunit ribosomal protein L24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327483
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327483
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4327483
  Archaea
    4327483
SSDB
Motif
Pfam: Ribosomal_L24e
Other DBs
NCBI-GeneID: 4327483
NCBI-ProteinID: XP_015620714
UniProt: B9ETV8 Q5N754
LinkDB
Position
1:34682469..34685375
AA seq 162 aa
MVLKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKRYFHNRLKPAKLTWTAMYRKQ
HKKDIHAEAVKKRRRTTKKPYSRSIVGATLEVIQKKRSEKPEVRDAAREAALREIKERIK
KTKDEKKAKKAEVAKSQKTQSKGGATQRGAKGPKIGGGGGKR
NT seq 489 nt   +upstreamnt  +downstreamnt
atggttctgaagactgaactttgccgttttagtgggcagaagatatacccaggcaagggt
atcaggttcattcgtgctgattcccaggtttttctgtttgccaactcgaaatgcaagcgc
tacttccacaaccgcctgaagcctgccaagcttacctggacagctatgtacaggaagcag
cacaagaaggacattcatgctgaagctgtcaagaagaggcgtcgcaccaccaagaagcca
tactcacggtcaattgttggtgctacactggaagttatccaaaagaagaggagtgagaaa
cctgaagtccgtgatgcagccagagaagcggctctccgtgagatcaaggagcgcatcaag
aaaaccaaggatgagaaaaaggcaaagaaggcagaggtggcaaaatctcagaagacacag
tcgaagggtggtgctacccagaggggtgctaaaggtcctaagattggcggcggtggtggg
aagcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339145
Entry
4339145           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L24
  KO
K02896  large subunit ribosomal protein L24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339145
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339145
  Archaea
    4339145
SSDB
Motif
Pfam: Ribosomal_L24e Spore_coat_CotO
Other DBs
NCBI-GeneID: 4339145
NCBI-ProteinID: XP_015640856
UniProt: Q75KZ3 B9FJY7
LinkDB
Position
5:complement(23939900..23943186)
AA seq 161 aa
MVLKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKRYFHNRLKPAKLTWTAMYRKQ
HKKDIHAEAVKKRRRTTKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERIK
KTKDEKKAKKAEVTKSQKSQSKGAAPRGSKGPKIGGGGGKR
NT seq 486 nt   +upstreamnt  +downstreamnt
atggtgctgaagacagagctttgccgttttagtggccagaagatatatccagggaagggc
attcgctttattcgtgctgattcacaggtcttcctttttgcaaactcaaaatgcaagcgc
tacttccacaaccgcctgaagcctgcaaagcttacctggacagccatgtacaggaagcag
cacaagaaggatatccatgctgaagctgtcaagaagaggcgccgcaccaccaagaagcca
tactctaggtcaattgttggtgcttcgttggaagtcatccaaaagaagagagctgaaaag
cctgaagttcgtgatgctgctagagaagctgctcttcgtgagatcaaggaacgcatcaag
aagaccaaggatgaaaagaaggcgaagaaggctgaggtaaccaagtcccagaagtcgcag
tcgaagggtgccgccccgaggggttccaagggcccgaagattggtggtggtggtggaaag
cgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342748
Entry
4342748           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L24
  KO
K02896  large subunit ribosomal protein L24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342748
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342748
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4342748
  Archaea
    4342748
SSDB
Motif
Pfam: Ribosomal_L24e DUF4407
Other DBs
NCBI-GeneID: 4342748
NCBI-ProteinID: XP_015645045
UniProt: Q0D7Q0
LinkDB
Position
7:6864606..6866879
AA seq 161 aa
MVLKTELCRFSGAKIYPGKGIRFIRADSQVFLFSNSKCKRYFHNRLKPAKLTWTAMYRKQ
HKKDIHAEAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAARESALREIKERIK
KTKDEKKAKKAEVAKSQKASGKGNAPKPGKGPKLGGGGGKR
NT seq 486 nt   +upstreamnt  +downstreamnt
atggttctcaagacagagctgtgccgtttcagcggcgccaagatttacccagggaagggt
atcagattcatccgtgcagactcccaggtgttcctgttttcaaactcgaagtgcaagcgc
tacttccacaaccgtctgaagccagccaagcttacatggacagccatgtacagaaagcag
cacaagaaggatattcacgccgaggcagtcaagaagaggcgccgcaccaccaagaaaccg
tactcccggtctatagttggtgctacccttgaagtcatccagaagaagagagctgagaag
ccagaggttcgtgatgcagcaagggaatccgctcttcgtgagatcaaggagcgcatcaag
aagacaaaggacgagaagaaagcgaagaaggcagaggtggcaaaatcgcagaaggcttct
ggtaaaggcaatgctcccaagcctgggaaaggcccaaagctcggtggtggtggtgggaag
cggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342953
Entry
4342953           CDS       T01015                                 
Name
(RefSeq) probable ribosome biogenesis protein RLP24
  KO
K02896  large subunit ribosomal protein L24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342953
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342953
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4342953
  Archaea
    4342953
SSDB
Motif
Pfam: Ribosomal_L24e GNAT_acetyltran
Other DBs
NCBI-GeneID: 4342953
NCBI-ProteinID: XP_015644961
UniProt: Q84ZF9 Q0D760
LinkDB
Position
7:11359277..11362392
AA seq 163 aa
MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRCLHG
KDMTQDSTFEFERKRNRPERYDRNVTEQTLKAISLITKIRHERQKKHITERQKQGKTKQR
ERDAKELEQDIQMLPKKVTLSTQKTKVVVKVSQQQTEENLMEE
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaggttggagaagtgctggttctgctcgtccaccgtctaccccggccacggcatccag
ttcgtccggaacgacgccaagatctttcgcttttgccggtcaaaatgtcataaaaatttc
aagatgaagaggaatcctcgtaaggttaaatggacaaaagcgtacaggtgcttgcatggg
aaggacatgacacaggactccacctttgagtttgagaggaaaaggaacaggccagagcgc
tatgaccggaatgtcactgagcaaacacttaaggctatctctcttattacaaagattaga
catgaacggcagaagaaacatattacagagaggcaaaaacagggtaagacaaagcaacgg
gagagggatgctaaggagttggaacaggatattcaaatgcttccaaagaaggttacccta
tcaacacaaaaaacaaaagtcgtggttaaagtttcccagcagcagacagaagagaatctt
atggaagagtaa

DBGET integrated database retrieval system