KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324004
Entry
4324004           CDS       T01015                                 
Name
(RefSeq) probable small nuclear ribonucleoprotein Sm D2
  KO
K11096  small nuclear ribonucleoprotein D2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4324004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4324004
   03032 DNA replication proteins [BR:osa03032]
    4324004
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4324004
  U2 snRNP components
    4324004
 Complex B
  U1 snRNP components
    4324004
  U4/U6.U5 tri-snRNP components
    4324004
 Complex C
  U2 snRNP components
    4324004
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4324004
SSDB
Motif
Pfam: LSM p450
Other DBs
NCBI-GeneID: 4324004
NCBI-ProteinID: XP_015640442
LinkDB
Position
1:complement(42638856..42643301)
AA seq 137 aa
MLAAHPEWQAAVREEVVEAAGRSGLLDAAALGKLTKMGCVLNEVLRLYQPSPNVQRQALQ
DVVVVLINCQNNKKLLGRVRAFDSHCNMVLENVREMWTEVPKTGKGKKKALPVNKDRFIS
KMFLRGDSVIIVLKNPK
NT seq 414 nt   +upstreamnt  +downstreamnt
atgctggcggcgcacccggagtggcaggcggcggtgcgggaggaggtggtggaggcggcc
gggcggtcgggcctcctcgacgcggcggcgctggggaagctgacgaagatggggtgcgtg
ctgaacgaggtgctccggctgtaccagccgtcgccgaacgtgcaaaggcaggcgctgcag
gacgtagtggtggtgcttatcaattgccagaacaacaagaagttactaggtcgtgtgagg
gcatttgatagccattgcaacatggttcttgagaatgtcagggagatgtggaccgaggta
ccaaagactggtaaaggcaagaagaaggctcttccagtgaacaaggacaggttcatcagc
aagatgttcctacgtggggactcggtcatcattgtgctcaaaaacccgaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327991
Entry
4327991           CDS       T01015                                 
Name
(RefSeq) small nuclear ribonucleoprotein SmD3b
  KO
K11088  small nuclear ribonucleoprotein D3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4327991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4327991
   03041 Spliceosome [BR:osa03041]
    4327991
   03032 DNA replication proteins [BR:osa03032]
    4327991
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     4327991
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4327991
  U2 snRNP components
    4327991
 Complex B
  U1 snRNP components
    4327991
  U4/U6.U5 tri-snRNP components
    4327991
 Complex C
  U2 snRNP components
    4327991
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4327991
SSDB
Motif
Pfam: LSM SM-ATX ADH_N
Other DBs
NCBI-GeneID: 4327991
NCBI-ProteinID: XP_015623168
UniProt: Q6YU78 B9F1P1
LinkDB
Position
2:complement(135304..138095)
AA seq 132 aa
MSRSLGIPVKLLHEAAGHVVTVELKTGEVYRGSMVECEDNWNCQLDNITFTAKDGKVSQL
EHVFIRGSRVRFMIIPDMLKNAPMFKRLEARIRGKGSAIGVGRGRAVAMRARAAAGRGGG
PVGRGGAPPVRR
NT seq 399 nt   +upstreamnt  +downstreamnt
atgagccgcagccttggtatcccagtgaagctgctgcacgaggcggcggggcacgtggtg
accgtggagctcaagaccggcgaggtgtaccgcggctccatggtcgagtgcgaggacaac
tggaactgccagctcgacaacatcaccttcaccgccaaggacggcaaggtctcccagctg
gagcacgtcttcatcagaggaagcagggtcaggttcatgatcatacccgacatgctcaag
aacgcccccatgttcaagcgcctcgaggctaggattaggggtaaaggctcagctattggt
gttggccgtggccgtgccgttgctatgcgtgctcgggctgctgctggtcgtggtggtggt
ccagttggacggggtggtgcacctcctgtgaggcggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328158
Entry
4328158           CDS       T01015                                 
Name
(RefSeq) small nuclear ribonucleoprotein E
  KO
K11097  small nuclear ribonucleoprotein E
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328158
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4328158
   03041 Spliceosome [BR:osa03041]
    4328158
   03032 DNA replication proteins [BR:osa03032]
    4328158
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     4328158
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4328158
  U2 snRNP components
    4328158
 Complex B
  U1 snRNP components
    4328158
  U4/U6.U5 tri-snRNP components
    4328158
 Complex C
  U2 snRNP components
    4328158
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4328158
SSDB
Motif
Pfam: LSM Hfq
Other DBs
NCBI-GeneID: 4328158
NCBI-ProteinID: XP_015625886
UniProt: Q6Z2M5 B9F286
LinkDB
Position
2:complement(1399278..1401351)
AA seq 88 aa
MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDEAEEI
NIKKDTRKSLGRILLKGDNITLMMNTGK
NT seq 267 nt   +upstreamnt  +downstreamnt
atggcgtccaccaaggtgcagaggattatgacccagcccatcaacctcatcttccgcttc
ctccagagtaaagcgcgcatccagatctggctcttcgagcagaaggacctccggattgag
ggcagaatcatcggctttgacgaatacatgaatttggtcttggatgaagctgaggagatc
aacataaagaaggacactagaaaatctctgggccggattctcttaaaaggagacaacatt
acattaatgatgaacacgggaaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328484
Entry
4328484           CDS       T01015                                 
Name
(RefSeq) probable small nuclear ribonucleoprotein F
  KO
K11098  small nuclear ribonucleoprotein F
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328484
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4328484
   03041 Spliceosome [BR:osa03041]
    4328484
   03032 DNA replication proteins [BR:osa03032]
    4328484
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     4328484
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4328484
  U2 snRNP components
    4328484
 Complex B
  U1 snRNP components
    4328484
  U4/U6.U5 tri-snRNP components
    4328484
 Complex C
  U2 snRNP components
    4328484
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4328484
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 4328484
NCBI-ProteinID: XP_015623279
UniProt: A0A0P0VFH8 Q6ETN4
LinkDB
Position
2:complement(4270607..4274295)
AA seq 86 aa
MATVPVNPKPFLNNLTGKPVIVKLKWGMEYKGYLVSVDSYMNLQLANTEEYIDGQFSGNL
GEILIRCNNVLYLRGVPEDTEIEDAE
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcgactgtgccagttaacccgaagcctttcttgaacaacctgacagggaagcctgtc
attgtcaaacttaagtggggtatggaatacaaaggatatcttgtttctgtcgactcttat
atgaatctgcagctggctaatacagaggagtatattgatgggcaattctctggaaacttg
ggtgagatactgataaggtgcaacaacgttttgtatctccgaggcgttccagaggatacc
gagatagaggatgcggaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329810
Entry
4329810           CDS       T01015                                 
Name
(RefSeq) small nuclear ribonucleoprotein Sm D1
  KO
K11087  small nuclear ribonucleoprotein D1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4329810
   03032 DNA replication proteins [BR:osa03032]
    4329810
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4329810
  U2 snRNP components
    4329810
 Complex B
  U1 snRNP components
    4329810
  U4/U6.U5 tri-snRNP components
    4329810
 Complex C
  U2 snRNP components
    4329810
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4329810
SSDB
Motif
Pfam: LSM Gemin7 BPL_C Hfq Tail_tube P2_N
Other DBs
NCBI-GeneID: 4329810
NCBI-ProteinID: XP_015626285
UniProt: A0A0P0VL01
LinkDB
Position
2:complement(22602363..22605787)
AA seq 114 aa
MKLVRFLMKLNNETVTIELKNGTTVHGTITGVDISMNTHLKTVKLTLKGKNPVTFDHLSV
RGNNIRYYILPDSLNLETLLVEDTPRVKAKKPTAGKPLGRGRGRGRGRGRGRGR
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaagctcgtcaggttcttgatgaagctgaacaacgagacggtaacgatcgagctcaag
aacggcaccaccgtccatggcaccatcactggtgttgatatcagcatgaacacgcacctg
aaaactgtgaaactcacattgaaagggaaaaatcctgttacctttgatcacctcagtgtg
aggggaaacaacattcgctattacattcttcctgacagcttaaacctggagacattgctg
gttgaggatacaccgagggtcaaggctaagaagccaactgcagggaagcctttggggcgt
gggcgcggccgtggtcgtgggcgcggtcgtggcaggggacgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332206
Entry
4332206           CDS       T01015                                 
Name
(RefSeq) small nuclear ribonucleoprotein SmD3b
  KO
K11088  small nuclear ribonucleoprotein D3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332206
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332206
   03041 Spliceosome [BR:osa03041]
    4332206
   03032 DNA replication proteins [BR:osa03032]
    4332206
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     4332206
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4332206
  U2 snRNP components
    4332206
 Complex B
  U1 snRNP components
    4332206
  U4/U6.U5 tri-snRNP components
    4332206
 Complex C
  U2 snRNP components
    4332206
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4332206
SSDB
Motif
Pfam: LSM SM-ATX ADH_N
Other DBs
NCBI-GeneID: 4332206
NCBI-ProteinID: XP_015632255
UniProt: Q10PA9 Q0DTL3
LinkDB
Position
3:7449787..7453020
AA seq 132 aa
MSRSLGIPVKLLHEAAGHVVTVELKTGEVYRGAMVECEDNWNCQLDNITFTAKDGKVSQL
EHVFIRGSRVRFMIIPDMLKNAPMFKRLEARIRGKGSAIGVGRGRAVAMRARAAAGRGGG
PVGRGGAPPVRR
NT seq 399 nt   +upstreamnt  +downstreamnt
atgagccggagcctggggatcccggtgaagctgctgcacgaggcggcggggcacgtggtg
acggtggagctcaagaccggcgaggtgtaccgcggcgccatggtggagtgcgaggacaac
tggaactgccagctcgacaacatcaccttcaccgccaaggatggcaaggtgtcgcagctg
gagcacgtcttcatcagaggaagcagagtgagatttatgattataccggatatgctcaag
aacgcacccatgttcaagcgcctggaagcaaggattaggggcaaaggatcagctattgga
gtcgggcgtggccgtgcggttgcaatgcgtgcccgggctgctgctggtcgtggtggtggt
cctgttggacggggtggtgcacctccggtgaggagatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333092
Entry
4333092           CDS       T01015                                 
Name
(RefSeq) probable small nuclear ribonucleoprotein G
  KO
K11099  small nuclear ribonucleoprotein G
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4333092
   03041 Spliceosome [BR:osa03041]
    4333092
   03032 DNA replication proteins [BR:osa03032]
    4333092
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     4333092
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4333092
  U2 snRNP components
    4333092
 Complex B
  U1 snRNP components
    4333092
  U4/U6.U5 tri-snRNP components
    4333092
 Complex C
  U2 snRNP components
    4333092
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4333092
SSDB
Motif
Pfam: LSM NotI
Other DBs
NCBI-GeneID: 4333092
NCBI-ProteinID: XP_015627963
UniProt: A3AJ10 Q75K32
LinkDB
Position
3:16941099..16943322
AA seq 80 aa
MSRSGQPPDLKKYMDKKLQIKLNANRVIVGTLRGFDQFMNLVVDNTVEVNGNDKTDIGMV
VVRGNSVVMIEALEPVPKSQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagccgatcggggcagcccccggatctcaagaagtacatggacaagaagctccagatc
aagctgaatgcaaaccgtgtaattgttggtacgctccgtggattcgatcagtttatgaat
ttggtggtggacaacacggtagaggtcaatggaaatgacaagactgatattggaatggtg
gttgtcagggggaacagtgttgtgatgattgaggcattggagccagtgcccaaatcccag
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336118
Entry
4336118           CDS       T01015                                 
Name
(RefSeq) small nuclear ribonucleoprotein Sm D1
  KO
K11087  small nuclear ribonucleoprotein D1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4336118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4336118
   03032 DNA replication proteins [BR:osa03032]
    4336118
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4336118
  U2 snRNP components
    4336118
 Complex B
  U1 snRNP components
    4336118
  U4/U6.U5 tri-snRNP components
    4336118
 Complex C
  U2 snRNP components
    4336118
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4336118
SSDB
Motif
Pfam: LSM Gemin7 BPL_C
Other DBs
NCBI-GeneID: 4336118
NCBI-ProteinID: XP_015635423
UniProt: A0A8I3B3K1
LinkDB
Position
4:complement(23495669..23499387)
AA seq 114 aa
MKLVRFLMKLNNETVTIELKNGTVVHGTITGVDISMNTHLKTVKLTLKGKNPVTLDHLSV
RGNNIRYYILPDSLNLETLLVEDTPRVKAKKPTAGKPLGRGRGRGRGRGRGRGR
NT seq 345 nt   +upstreamnt  +downstreamnt
atgaagctcgtcaggtttctgatgaagctgaacaacgagacggtcaccatcgagctcaag
aacggcaccgtcgtccacggaaccatcaccggtgtggatataagcatgaacacccacttg
aagactgttaagctcacattgaaagggaaaaatcctgtaacccttgaccacctcagtgtg
agaggaaacaacattcgctattacatcctccctgatagcttaaatctggaaactttacta
gtagaggataccccgagagtcaaggctaagaagccaactgcagggaaacctttggggcgt
gggcgcggacgcggtcgtggccgtggtcggggccgggggcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338385
Entry
4338385           CDS       T01015                                 
Name
(RefSeq) small nuclear ribonucleoprotein Sm D2 isoform X1
  KO
K11096  small nuclear ribonucleoprotein D2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338385
   03032 DNA replication proteins [BR:osa03032]
    4338385
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4338385
  U2 snRNP components
    4338385
 Complex B
  U1 snRNP components
    4338385
  U4/U6.U5 tri-snRNP components
    4338385
 Complex C
  U2 snRNP components
    4338385
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4338385
SSDB
Motif
Pfam: LSM Hfq
Other DBs
NCBI-GeneID: 4338385
NCBI-ProteinID: XP_015637506
LinkDB
Position
5:complement(14449689..14452306)
AA seq 106 aa
MAEEATQQGKKEEEEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLE
NVREMWTEVPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNPK
NT seq 321 nt   +upstreamnt  +downstreamnt
atggcggaggaagccactcagcaggggaagaaggaggaggaggaattcagtacggggccg
ctgtccgtgctgatgatgagcgtgaagaacaacacccaggtgcttatcaattgccggaac
aacaagaagttgcttggtcgtgtgagggcatttgatcgccattgcaacatggttcttgag
aatgttagggagatgtggactgaggtaccaaagactggtaaaggcaagaagaaggctctt
ccagtgaacaaggacaggttcattagcaagatgttcctacgtggggattcggtcatcatt
gtgctcaggaacccgaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343870
Entry
4343870           CDS       T01015                                 
Name
(RefSeq) probable small nuclear ribonucleoprotein G
  KO
K11099  small nuclear ribonucleoprotein G
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4343870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4343870
   03041 Spliceosome [BR:osa03041]
    4343870
   03032 DNA replication proteins [BR:osa03032]
    4343870
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     4343870
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    4343870
  U2 snRNP components
    4343870
 Complex B
  U1 snRNP components
    4343870
  U4/U6.U5 tri-snRNP components
    4343870
 Complex C
  U2 snRNP components
    4343870
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     4343870
SSDB
Motif
Pfam: LSM NotI
Other DBs
NCBI-GeneID: 4343870
NCBI-ProteinID: XP_015647578
UniProt: Q6YTY0 A0A8J8XSF2
LinkDB
Position
7:complement(25036708..25039115)
AA seq 80 aa
MSRSGQPPDLKKYMDKKLQIKLNANRVVIGTLRGFDQFMNLVVDNTVEVNGNEKNDIGMV
VIRGNSVVMIEALEPVPKPQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagccgatcggggcagcctccggatctgaagaagtacatggacaagaagctccaaatc
aagctgaatgcgaaccgtgttgtcattggcactcttcgaggattcgatcagtttatgaat
ttggtcgtggacaacacagtggaggtcaatggaaacgagaagaatgacatagggatggtg
gttatcaggggaaacagtgttgtgatgattgaagccctcgaacctgttcccaagccgcag
tga

DBGET integrated database retrieval system