KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324031
Entry
4324031           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 13 homolog B
  KO
K03039  26S proteasome regulatory subunit N9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4324031
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4324031
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4324031
SSDB
Motif
Pfam: PCI
Other DBs
NCBI-GeneID: 4324031
NCBI-ProteinID: XP_015622388
UniProt: A0A0P0V367
LinkDB
Position
1:complement(17999340..18002903)
AA seq 385 aa
MALQYVEAQRQARPDLADAYADLADLYQRKLWHQLTLKLDHFLQLPAAQTGDTIIQLYNN
FISDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVTAKLRETRERRIDEPVLYVKMQ
IAAINLEKGDQKECKKLLDEGKSTLDSMTDVDPTVHASFYWISSQYHKACQEFAEFYKNA
LLYLAYTTVESLSESFKLDLAFDLSLAALLGDNIYNFGELLAHPIINSLIGTKVEWVYHM
LQAFNTGNLALYQELCKVHNAALSAQPALVQNERKLLEKINILCLMEIIFTRPSEDRTIP
LSVIAERTKLSISDVEYLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVKALRER
LDAWVGKVHTTLLSVEAETPDLVAA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcgctgcagtacgtggaggcacagcgccaggcgcgccccgacctcgccgacgcctac
gccgacctcgccgacctctaccagcgcaagctctggcaccagctcaccctcaagctcgac
cacttcctccaactccccgccgcccagactggcgacaccatcatacagctctacaacaat
ttcatctctgacttcgagacgaagatcaatcttctcaaacttgcccacttcgcggtcatc
gcttcacgccagtaccctgacaaggatgccgcgattagtttcctcgagggggtaaccgca
aaactgcgcgagacgagggaacggcgcatcgatgaacccgttctctatgtcaagatgcag
atagctgcaattaaccttgagaagggagatcaaaaggagtgcaagaagcttttggatgaa
gggaaatccacccttgatagcatgactgatgttgatcccacagtccatgctagcttttat
tggatatcatctcagtaccataaggcttgccaagaattcgctgaattctataagaatgct
cttctttatctggcctacactactgtggagtcgctctctgagtcattcaagctggatttg
gcatttgatctctcccttgcagccttgcttggtgataacatatacaactttggggaatta
ttagctcacccgattatcaacagtctaattggaaccaaggtggagtgggtctatcatatg
ttgcaagcattcaacactggcaacctagctctctaccaagaactttgcaaggtccacaac
gctgctcttagtgcacagccagctttggtgcagaatgaacgaaaactgctagagaagatc
aacattctatgtctgatggagataatctttacccggccatcagaagacagaactatccca
ttaagtgttatagctgagcgcactaagctttctatcagtgatgtggaatatcttcttatg
aagagcctctcggttcatcttatagaagggataattgatgaggtggacagcacagttcac
gtgtcatgggtccagcctagagtacttggaattccacaggtgaaggccttgcgtgagcgg
ctggacgcatgggtcggaaaagttcacactacactgttgtcagttgaggcagagacccct
gatcttgtggctgcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332055
Entry
4332055           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 13 homolog B
  KO
K03039  26S proteasome regulatory subunit N9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4332055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4332055
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4332055
SSDB
Motif
Pfam: PCI
Other DBs
NCBI-GeneID: 4332055
NCBI-ProteinID: XP_015630519
UniProt: Q10Q05 A0A8J8XKV7
LinkDB
Position
3:5999877..6003771
AA seq 385 aa
MALQFVESQREARPELADPYADLADLYQRKLWHQLTLKLDHFLQLPAAQTGDTLIQLYNN
FITDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVITKLRETKDLRINEPILYVKMQ
IAAINLEKGNQKECKKLLDEGKSTLDSMTDVDPTVHASLYWISSQYHKARQEFAEFYKNA
LLYLAYTTVESLSESFKLDLAFDLSLAALLGDNIYNFGELLAHPIINSLIGTKVEWVYHM
LQAFNTGNLALYQELCRVHNAALSAQPALVQNERKLLEKINILCLMEIIFSRASEDRTIP
LSVIAERTKLSISDVEYLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVKALRER
LDAWVGKVHTTLLSVEAETPDLVAA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcgctgcagttcgtcgagtcgcagcgcgaggcgcggccggagctcgccgacccgtac
gccgacctcgccgacctctaccagcggaagctctggcaccagctcaccctcaagctcgac
cacttcctccagctccctgccgcgcagacgggtgacaccctcatacagctctacaacaat
ttcatcactgatttcgagacgaagatcaatcttctcaaacttgcgcatttcgcggtcatc
gcttcgcgccagtaccccgacaaggatgctgctataagtttcctcgagggggtaatcaca
aaattgcgcgagacaaaggacctgcgcatcaatgaacccattctctacgtcaagatgcaa
atcgctgcgattaacctggagaagggaaatcagaaggagtgcaagaaacttttggacgaa
ggaaaatctactctagatagcatgactgatgttgatcccacagttcatgctagcctctac
tggatatcatctcagtaccataaggctcgccaagaatttgctgagttctacaagaatgcc
cttctgtatctggcttacactactgtagagtcactctctgagtctttcaaactggatttg
gcatttgatctctcccttgcagccttgcttggtgataacatctacaactttggggaattg
ttagctcacccgattatcaacagtcttattggaaccaaggtggagtgggtctatcatatg
ttacaagcattcaacaccggcaacctagctctctaccaagaactatgtagggtccacaat
gctgctctcagtgctcagccagctttggtgcagaatgaacggaaactgctagagaagatc
aacattctatgtctgatggagataatctttagccgggcgtcagaagacagaactatccca
ttaagtgttatagccgagcgcactaagctttctatcagtgatgtggaatatcttcttatg
aagagcctctcggttcatcttatagaggggataattgatgaggtggacagcacagttcac
gtgtcatgggtccagcctagagtacttggaattccacaggtgaaggcgttgcgcgagcgg
ttggacgcctgggttggaaaagtgcataccaccctgttgtccgttgaggcagagacgcct
gatcttgtagctgcataa

DBGET integrated database retrieval system