KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324062
Entry
4324062           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4324062
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4324062
   00592 alpha-Linolenic acid metabolism
    4324062
   01040 Biosynthesis of unsaturated fatty acids
    4324062
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4324062
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4324062
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4324062
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 4324062
NCBI-ProteinID: XP_015622170
UniProt: Q5ZEL4 A0A0P0UYM1
LinkDB
Position
1:complement(3108229..3114024)
AA seq 433 aa
MAGKQGDGREEDGAKVGLPALDISLAFPQATPASIFPPSASDYYQIDDLLTTEEQSIRKN
VRAIMEKEIAPIMATYWEKAEFPFHAIPKLSSLGVAGGTIKGYGCPGLSITASAITMAEI
ARVDASCSTFILVHSSLAMVTIALCGSEVQKQKYLPSLAQLTAVGCWALTEPNHGSDASS
LITTATKVPGGWHIDGQKRWIGNSTFADVLVVLARNANTKQLNGFIVRKGAPGLKATKIE
NKIGLRMVQNGDIVFNKVFVPEEDRLPGVNSFQDISKVLAISRVMVAWQPIGISMGVFDV
CHRYLKERKQFGVPLVAFQLNQEKLVRMLGNIQAMLLVGWRLCKLYESGKMTPGHASLGK
GWTSRMAREVVSLGRELLGGNGILADFLVAKAFCDLEPIYSYEGTYDINSLVTGREITGI
ASFKPAALAKARL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcggggaagcaaggagatgggcgcgaggaggatggcgctaaggtcggcctcccggcg
ctggatatctcgctcgcgtttccgcaggccacgccggcatccatcttcccgccatcagca
tcggactattatcagattgatgatttactcaccactgaagagcagtctatcaggaagaat
gtcagggctataatggagaaagaaattgcacccattatggcaacgtactgggagaaagca
gagttcccatttcatgccattcctaaactttcaagcctcggtgtagctggaggcacaata
aagggatatgggtgcccaggactttcaataacagcaagtgctattactatggcagaaatt
gcacgggtagatgcaagctgctccacgttcattctagtacactcctcccttgcaatggtc
acaatagctctttgtggatctgaggttcagaagcagaagtacttgccatcccttgctcaa
cttactgctgttggttgctgggcattgacagaaccaaatcatggaagcgatgcaagctct
ttgataactacagcaaccaaggtacctggtgggtggcacatagatggacaaaaacgctgg
attggtaacagtacttttgctgatgtgctcgtggtattagctaggaatgccaatacaaaa
caactaaatggatttattgtgaggaagggtgctcctggcttgaaagctacaaagattgag
aacaaaattggtctcagaatggttcagaacggtgatatagtttttaataaagtatttgtc
cctgaggaagatcgactgccaggtgtcaattcatttcaggatataagcaaggtccttgct
atttcacgtgtcatggtggcatggcaaccgattggtatatcaatgggggtgtttgatgtc
tgccatcggtatctgaaagaaaggaaacagtttggagttcctctagtagcttttcagctg
aaccaagaaaaacttgtgcgaatgcttggtaacatccaagcgatgcttcttgttggctgg
cgactatgcaagctttatgagtcagggaaaatgacaccagggcatgctagtttagggaag
ggttggacttccagaatggctcgtgaggtggtttctctcggtcgagaattgttgggtgga
aatggaattttggctgattttctagttgcaaaggcattctgtgacctggagcctatatac
tcatacgaaggcacatacgacatcaacagcctggtgactggtagagaaataactgggatc
gcaagcttcaaacctgccgcattagcaaaagctcggttataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331150
Entry
4331150           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00592  alpha-Linolenic acid metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4331150
   00592 alpha-Linolenic acid metabolism
    4331150
   01040 Biosynthesis of unsaturated fatty acids
    4331150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4331150
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4331150
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     4331150
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Other DBs
NCBI-GeneID: 4331150
NCBI-ProteinID: XP_015625435
UniProt: Q84P96 Q6K9V2
LinkDB
Position
2:complement(35081024..35085213)
AA seq 448 aa
MEKAIDRQRVLLAHLLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTPIC
KAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAFYA
GVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNPKV
NEVQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATAAGKFKDEIVPVPT
KIVDPKTGEEKKVVISVDDGIRPGTTASGLAKLKPVFRKDGTTTAGNSSQVSDGAGAVLL
MRRDVAMKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFELNEA
FASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVT
MCIGSGMGAAAVFERGDSVDQFSNVRHH
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggagaaggcgatcgatcgccagcgcgtcctcctcgcccacctcctcccctcctcctcc
tccgaccaatcgctcctctccgcgtcggcgtgcgccgccggggacagcgccgcctaccag
aggacttccgcctacggggacgacgtcgtcgtcgtcgctgcctacaggacacccatatgc
aaggccaagcgaggaggtttcaaggatacatacccagaggaccttcttactgttgttcta
aaggctgttctggacaacactaagatcaaccctggtgaaattggtgacattgtagttggc
acggtgctaggtccaggctcgcagcgtgcaatcgagtgcagggctgcggctttctatgct
ggagttcccgaaaacgttcctgttagaactgtcaaccggcaatgttcctctggattacag
gcagtggctgatgttgccgcggccattaaagctgggttctacgacatagggattggtgca
ggcctggaatccatgtcagtaaatgctatgggttgggaaggacaagtaaaccctaaagta
aatgaagtccagaaagcacaggattgtcttttgcccatggggataacgtccgaaaatgtt
gcgcaccgatatggtgtaacaagacaagagcaggatcaggctgctgctgagtctcatagg
agggctgctgcagccacagctgctgggaaattcaaagatgagattgttccggtgcctaca
aagattgttgaccccaagactggagaggaaaagaaagttgtgatatcagttgatgatgga
attaggccagggaccacagcatctggattggcaaagcttaaaccagttttccggaaggat
ggtaccacaactgcaggcaactctagtcaagtgagcgatggtgctggagctgttcttctc
atgaggagggacgtagcgatgaagaagggacttcctattcttggtgttttcaggagcttt
gctgctgttggagtagatcctgctgttatgggtgttggtcctgcagtagcaataccagct
gcagtgaagtctgctggactccagattgaagacattgatctgtttgaattgaatgaggcc
ttcgcttcgcagttcgtgtattgctgcaacaagctgggactggacaggtcaaaagtaaac
gtgaatggaggcgcaatcgccctaggacatcctcttggtgcaacaggtgcccggtgcgtc
gcaactcttctgaatgaaatgaagcgccggggcagggactgcagattcggtgttgtcacc
atgtgcattggatctggcatgggggcagcagctgtgtttgagcggggtgactcggtcgac
caattctcaaacgtgcgccaccattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337904
Entry
4337904           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4337904
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4337904
   00592 alpha-Linolenic acid metabolism
    4337904
   01040 Biosynthesis of unsaturated fatty acids
    4337904
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4337904
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4337904
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4337904
SSDB
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 4337904
NCBI-ProteinID: XP_015639971
UniProt: B9FMM4 Q75IR2
LinkDB
Position
5:complement(3730643..3735258)
AA seq 430 aa
MGSLAGGGGGGKVGLPALDVALAFPQATTASQFPPAVSDYYQFDDLLTDEEKTLRKKVRG
IMEREIAPIMTEYWEKAEFPFHAIPKLATLGLAGGTTKGYGCPGLSLTASAISVAEVARV
DASCSTFILVHSSLAMSTIALCGSEAQKQKYLPSLTQFRTIGCWALTEPDYGSDASSLRT
AATKVPGGWHLDGQKRWIGNGTFADVLIILARNSDTNQLNGFIVKKGAPGLKCTKIENKI
GLRMVQNADIVLNKVFVPDEDRLTGINSFQDINKVLAMSRIMVAWQPIGISMGVFDMCHR
YLKERKQFGVPLAAFQLNQEKLVRMLGNIQAMLLVGWRLCKLYESGKMTPGHASLGKAWT
SKKAREVVSLGRELLGGNGILADFLVAKAFCDLEPIFSYEGTYDINSLVTGREITGIASF
KPAALTKSRL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggggagcttggcaggcggcggcggaggcggcaaggtggggctgccggcgttggacgtc
gcgctcgcgttcccgcaggccacgacggcgtcccagttcccacccgccgtatcggattac
taccagtttgatgatttgcttactgatgaagagaagacacttaggaagaaagtccgtggt
attatggagagagaaattgcacccattatgacagagtactgggagaaagcagaatttccc
ttccatgccattcccaaacttgcaactcttggcttggcaggagggacaacaaagggatat
ggttgcccaggactctcacttacagctagtgctatttctgttgcagaagttgcacgggtg
gatgccagctgctccacatttattttagtacattcctctttggcaatgagcacaattgca
ctttgtggatcagaggctcaaaagcagaagtacttaccatcattaacgcagtttagaaca
attggttgctgggcattgacagagccagattatggaagtgatgcaagttcattaaggact
gcagcgaccaaggtgcctggcggttggcatttggatggccaaaagcgttggataggcaac
ggcacttttgcagatgtgctcatcatcttagctagaaattcagatacaaatcaactaaat
ggatttattgtcaagaaaggagctcctggtttgaaatgtacaaaaattgaaaataaaatt
ggactcagaatggttcagaatgccgacattgttctgaataaagtatttgtccctgacgaa
gatagattaactggaatcaattcatttcaagacataaacaaggtccttgctatgtcgcgc
attatggtggcatggcagccaattgggatatccatgggggtcttcgacatgtgtcatcgg
tatttgaaagaaagaaagcaatttggagttccgttggcagcttttcagctcaaccaagaa
aagcttgttcgcatgctaggaaacatccaagccatgcttcttgtcggctggcgcctgtgc
aagctgtatgaatcaggcaaaatgacaccaggccatgctagtttaggcaaggcatggaca
tccaagaaggctagggaggtggtttctcttggccgtgagctactgggtggaaacggaatt
ttggctgactttctggtagcaaaggcgttctgtgatctggagccaatcttctcgtacgaa
ggcacctatgacatcaacagcttggtgaccggaagagagatcaccggaatcgccagcttc
aaacctgctgcattgacaaaatctcgtctttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339846
Entry
4339846           CDS       T01015                                 
Name
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4339846
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4339846
   00592 alpha-Linolenic acid metabolism
    4339846
   01040 Biosynthesis of unsaturated fatty acids
    4339846
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4339846
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4339846
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4339846
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-GeneID: 4339846
NCBI-ProteinID: XP_015643031
UniProt: A3B7J2 Q8H631
LinkDB
Position
6:227706..232767
AA seq 669 aa
MEGGVGGEVDHLAGERATAQFDVEHMKVAWAGSRHAVDVADRMARLVASDPVFRKDNRTM
LPRKELFKDTLRKAAHAWKRIVELRLTEEEANLLRLYVDQPGYVDLHWGMFVPAIKGQGT
EEQQKKWLPLAYRFQIIGCYAQTELGHGSNVQGLETTATFDPKTDEFVIHSPTLTSSKWW
PGGLGKASTHAVVYARLITEGKDYGIHGFIVQLRSLEDHSPLPGVTLGDIGGKFGSGAYN
SMDNGVLRFDHVRIPRDQMLMRLSQVTKEGKYVHSDVPKQLLYGTMVFVRQTIVADASKA
LSRATCIAVRYSAIRKQFGPQTGGPETQVLNYKTQQSRLFPLLASAYAFRFVGEWLKWLY
TDVTHKLEAKDFSTLQEAHACTAGLKAVTTSATADGIEECRKLCGGHGYLNSSGLPELFA
IYVPACTYEGDNVVLLLQVARFLMKTVSQLASGKQPVGTTAYMGNIQYLMQCKCGVNTAE
DWLNPAAIREVFEARALRMAVNCAQNINKAPSQEEGFYELSPDLLEVAVAHIQLIIVTKF
IEKLEQDIPGEGVKEQLCILCNVYALYLVHKHLGDFLSTGSITARQGALANEQLGKLYAQ
VRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEAWKDPLNDTDVPDGYQEHLRPLL
KQQLKLSRL
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggagggcggcgtagggggggaggtggaccacctcgccggcgagagggccaccgcgcag
ttcgacgttgaacacatgaaggttgcctgggctggctcccgccacgccgtcgatgtcgcc
gaccgcatggcgcgcctcgtcgcttccgaccccgtgttccgcaaggataacaggactatg
ctccccaggaaggagctgttcaaggacacactcagaaaggcagcccatgcgtggaagcgt
atcgtcgagctccgtcttacagaagaggaggcaaatttgctaaggctatacgtggaccag
cctggttatgttgatctgcactggggcatgtttgttcctgctataaaaggccaagggact
gaagagcagcagaagaagtggctacctctggcctacaggttccaaataattggatgctat
gctcagactgaacttggtcatggttccaatgttcagggccttgaaacaaccgccacattt
gacccaaagactgatgagtttgttatacacagcccgacactgacctctagcaagtggtgg
cctggtggcttgggaaaagcttccactcatgcagttgtgtatgctcgtctgataactgaa
ggaaaggactacggcatacatggtttcattgtgcaactacgaagcctagaggaccactct
ccccttcccggtgttactcttggtgatatcggcggaaaatttggtagtggtgcatacaac
agtatggataatggagttctgcgatttgaccatgtgcgcatcccaagggatcaaatgttg
atgaggctttcacaagttacgaaagagggaaaatatgtgcactcagatgtcccaaaacag
ctgctttatgggacaatggtttttgttcgtcaaacaattgttgcagatgcttctaaggct
ttatcacgtgctacttgcattgctgtaagatacagcgctattcgaaagcagtttggccct
caaactggtggccctgagactcaggtcctcaattacaagactcagcaaagcagactcttt
cctttgctggcttcagcttatgcatttaggtttgtgggtgagtggctgaagtggctgtac
acggatgtcacacataaactggaagccaaggatttctcaacacttcaagaggcccatgcc
tgtactgctgggttgaaggctgtgacaacatctgcgacagctgatggaattgaagaatgc
cgaaaactctgtggtggacatggttacctgaacagcagcgggcttcctgaattgtttgct
atctatgttcctgcttgcacttatgaaggagacaatgttgttttgctattgcaggttgca
aggtttctaatgaagactgtatcccagttagcttctggaaaacagcctgttggtacaacg
gcttacatgggcaacatacagtacttgatgcaatgcaaatgtggtgtaaatacagctgaa
gattggctaaatcctgctgccatacgagaggtatttgaagctcgggctctcaggatggcg
gtgaattgtgcccagaacataaacaaggcgccaagccaagaagaagggttttatgagcta
tcccctgatctgcttgaggtggcggtggcccatatccagttgataattgtaaccaagttc
atagagaaattagagcaggacatccctggtgagggagtgaaggagcaactgtgcatcctt
tgcaatgtgtacgcgctgtatcttgttcacaagcatctgggtgacttcctgtcgacgggg
agcatcacagcaaggcagggagcgctggcaaacgagcagctgggaaagctgtatgcgcag
gtgcggccgaacgcggtggcgctggtggacgcgttcaactacaccgaccactacctgggg
tcggtgctggggcgctacgacggcaatgtttacccggcgctgtacgaggaggcgtggaag
gaccccctcaacgacacggatgtgccggacggttaccaggagcacctccgccctctgctc
aagcagcagctcaagctctccaggctatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340972
Entry
4340972           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4340972
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4340972
   00592 alpha-Linolenic acid metabolism
    4340972
   01040 Biosynthesis of unsaturated fatty acids
    4340972
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4340972
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4340972
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4340972
SSDB
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 4340972
NCBI-ProteinID: XP_015644169
LinkDB
Position
6:13876771..13897589
AA seq 420 aa
MVIRFEGLVMGSSELRSPTLNLSIACPQLTPAASTFPAAASNYCQLDELLTEEEKDLQIK
VRQFMENEVAPIISKFWEKAEFPFHLIPKMSTLGIAGGTIKGYGCPGLSGPACAMCFLEI
ARVDASIASFCLVQSCLAMVSIAQLGSEAQKEKYLRPLSKMQKVCVYALSEPNHGSDASS
LNTTARKVPGGWILNGQKRWPANSSFADIFVVLACNTSTNQINGFIVNGGAPGLKISKID
NKMSLRVVQNCDILLEDVFVPDDDRLPGANSFQDLVKALSFSRVIVAWISIGIAAGVYDA
CLRYLGERKQFGAPLAAFQLNQEKLMWLLGWRLYELHDSGRMTTGQASLGKAWITKKARE
TVALGRELLGGNGIVTDFHVGKAFCDMESLYTYEGSYEVNALIVARDITGIASIRPASRL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggtgataagatttgaaggtcttgtaatggggtcttcagagctcaggtcaccgactttg
aacttgtccatagcttgcccccagcttacaccagctgcgtcgacctttccagcagcagca
tccaactattgccagcttgatgaactgctgacagaagaggaaaaggatctacaaatcaaa
gtccggcagtttatggagaatgaagttgcaccaataatatccaagttttgggagaaggcc
gaattcccgtttcatcttattccaaagatgagcactctcggaattgctggaggaactata
aagggctatggatgccctggactttctggcccagcttgcgccatgtgttttctagagatc
gctcgtgtggatgcaagcatagcctcattctgccttgttcagtcatgcctcgcaatggtt
agcattgcacaactcgggtcagaagcccagaaggagaagtatttgcgaccattgagcaaa
atgcagaaagtttgcgtatatgccttgtcagagccgaaccatggtagtgacgcgagctct
cttaacaccacagctagaaaggttcctggagggtggatactcaatggccagaagcgatgg
ccagcaaacagcagttttgcagatatcttcgtcgttcttgcctgcaataccagcaccaat
cagattaacggattcattgtgaatggaggcgcccccgggcttaagatcagcaagatcgac
aacaagatgtcgctgagggtcgtccagaactgcgacatcctgctggaggacgtcttcgtc
cctgatgatgaccgtcttcctggcgccaactctttccaagacctagtgaaggccctctct
ttctctcgcgtcatcgtcgcctggatcagtatcggcattgcggcaggggtgtacgacgca
tgccttcggtatctgggagagaggaagcagtttggggcgccattggcggcgttccagcta
aaccaggagaagctcatgtggctcctcggctggcgtctctacgagctgcatgactccggc
aggatgaccaccggccaggccagcttagggaaggcatggatcacaaagaaggcgcgggag
actgtggccttgggcagggagttgctcggtggcaacggcatcgtcaccgacttccacgtt
ggcaaggcgttctgcgacatggagtccttatacacgtacgagggcagctatgaagtcaat
gcactcatcgttgctagagacatcactggcatcgccagcatcaggccggctagccggctc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340976
Entry
4340976           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4340976
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4340976
   00592 alpha-Linolenic acid metabolism
    4340976
   01040 Biosynthesis of unsaturated fatty acids
    4340976
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4340976
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4340976
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4340976
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 4340976
NCBI-ProteinID: XP_015642306
LinkDB
Position
6:13919440..13951272
AA seq 252 aa
MTLLSYTKNMVPGGWILNGQKRWPANGSFADVFVVLACNTSNNQINGFIVNGGSPGLKIS
KIENKTSLRVVQNCDILLEDVFVPDDDRLPGANSFQDLVKALSFSCVIVAWISIGIAAGV
YDACLRYLGERKQFGAPLAAFQLNQEKLVRMLGNIQAMWLLGWRLCKLHDSGRMTTGQAS
LGKAWITKQARETVALGRELLGGNGIVTDFHVGKAFCDMESIYTYEGSYEVNVLVAAREI
TGIASIRPTSRL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaccctcttgagctacacaaagaacatggttccaggagggtggatcctcaatgggcag
aagcgatggccggccaacggcagttttgcggatgtgttcgtcgttcttgcctgcaatacc
agtaataatcagattaacgggttcattgtgaatggtgggtccccagggcttaagatcagc
aagatcgagaacaagacgtcgctgagggttgtccagaactgtgacattctgctggaggac
gtgttcgtccctgacgatgaccgtcttcccggcgccaactctttccaagacctagtgaag
gccctctctttctcttgcgtcatcgttgcctggatcagcatcggcattgcagcaggggtt
tatgatgcatgcttacggtatctgggggagaggaagcagttcggggcgccattagcggcg
ttccagctgaaccaggagaagctagtgaggatgctgggcaacatccaggcgatgtggctc
ctcggctggcgtctctgcaagctgcacgattccggcaggatgaccactggccaggccagc
ctggggaaggcatggatcacaaagcaggcacgggagacggtcgccttgggcagggagttg
ctcggtggcaacggcatcgtcaccgattttcacgtcggcaaggcattctgcgacatggaa
tccatatacacgtatgagggcagctacgaagtaaacgtgctcgtcgctgcccgagagatc
acgggcatcgccagcattaggccgactagccggctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340986
Entry
4340986           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4340986
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4340986
   00592 alpha-Linolenic acid metabolism
    4340986
   01040 Biosynthesis of unsaturated fatty acids
    4340986
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4340986
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4340986
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4340986
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Other DBs
NCBI-GeneID: 4340986
NCBI-ProteinID: XP_015644121
LinkDB
Position
6:complement(14504081..14512981)
AA seq 688 aa
MEPMSSSPAASRRAAAIARHLAGIPAAKFASLLEPFSCLGYVPPESNEQPPAFALGDLRR
LLDGHDLGVRDWMFRVMEQSTLFCSRHGGPGPAGRVFASPDFNKDKEGLREAKMRRIGYL
ARRGVFRGWLTDTEGDAEAELRRIALLDCIGVYDHSLAIKIGVHFFLWGSAIKFLGTKRH
HDKWLSDTENYVIKGCFSMTELGHGSNVRGIETVATYDIKTREFVINTPCESAQKYWIGG
AANHATHTIVFAQLHINGRNEGVHAFVAQIRDEHENVMPNIQIADCGHKIGLNGVDNGRI
WFNNIRVPRENLLNLVADVLPDGQYVSTIDDPDQRFAAFLSPLTLGRVNIAVNAVYISKV
GVAIAVRYALSRRAFSVTPDGPEMLLLDYPSHQRRLLPLLAKACLMSSAGNFMKRMYVKR
TPELNKSIHIYSSALKATLTWQNMTTLQECREACGGQGLKTENRIGIFKAEFDVQSTFEG
DNNVLMQQVSKALYAEFLTAKRKNQPFKGLGLEHLNGPCPVIPDYLTSGTLRSSSFQMDL
LCLRERDLLKRFTTEVSNYLAQGENREKALMLSYQLAEDLARAFTERTILQIFLEDEKNI
PTGSLKDILGLLRSLYVMVCIDESASFLRYGCLSRENVAAARKEVMTLCSELRPHALAIV
SSFGIPDAFLSPLAFDWIEANARSSGNE
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggaacccatgtcctcctcgccggccgccagccggcgcgccgcagcgattgcccgccac
ctcgccggcattccggctgccaaattcgcctccctgctcgagccattctcctgcctgggc
tacgtgccgccggagtccaatgagcagcccccggcgttcgcgctaggcgacctccggagg
ctgctcgacgggcacgacctgggcgtgcgggactggatgttccgcgtcatggagcagagc
acattgttctgcagccggcacgggggccccggacctgcaggcagggtgttcgcatcgccg
gacttcaacaaggacaaggaggggctgcgggaggcgaagatgaggcggatcgggtacctg
gcgcggcgcggcgtattccgtggatggctcacagacacggagggcgacgccgaggccgag
ctccgcaggatcgcgctcctcgactgcattggcgtctacgatcactcgctcgccatcaag
atcggcgtccatttcttcctctggggcagcgcaatcaagtttcttggaacaaagcgccac
catgacaaatggttgtcggacacagaaaattatgttatcaagggttgtttttccatgaca
gaactgggtcatgggagcaatgtccgaggaattgagacagtggctacttatgatattaaa
acaagagagtttgtgataaatactccttgtgaatcagcccagaagtactggattggtgga
gctgctaatcatgctacacatactatagtctttgcgcagctccatataaatgggagaaat
gaaggagtccatgcttttgtagctcagattagggatgaacatgaaaatgttatgcctaat
atccagatagctgactgtggccataaaattggattaaatggtgttgataatggacgaatt
tggtttaacaatatacgtgttcctcgagagaatttgctgaatcttgttgctgatgttttg
ccggatgggcaatatgttagcacgatagatgaccctgatcagaggtttgcagcattttta
tctccacttacacttggtcgagttaatattgcagttaatgcggtttatatttcaaaggtt
ggcgttgcaattgctgtgagatatgctttgtcaaggagagccttttcagttacaccggat
ggtcctgaaatgctgttacttgattatcccagtcaccagcgacgccttctaccactgcta
gcaaaagcatgtctgatgagcagtgctggtaattttatgaaaaggatgtatgtgaagagg
actcctgaacttaacaaatctatacacatttactctagtgctcttaaagctacacttacc
tggcagaatatgaccacacttcaggagtgccgtgaagcttgtggtggccaaggtttgaag
acagagaatcgcataggaattttcaaagctgaatttgatgtccagtctacatttgagggc
gacaataatgttctaatgcagcaggtaagcaaagccctttatgctgaatttttgacagca
aaaaggaagaatcaaccattcaagggattgggcttggaacacttgaatggtccttgccct
gttattcctgattatctgacaagtggcacactaagaagctccagtttccagatggacttg
ctctgcttgagggagcgagatttactgaaacgattcaccacggaggtttctaactatctg
gcacaaggagaaaacagagagaaggctttgatgctgagctaccaactcgctgaagactta
gctagagcatttactgagcgcacaattttgcaaatatttttggaggatgagaagaatatt
cctactggttctttaaaggatatattgggcttactaaggtctttatatgttatggtttgc
atagacgaatctgcatcctttttgagatatggttgcctatcgcgagagaatgtagccgct
gctaggaaagaagtgatgacactgtgcagtgaactcaggccccacgcacttgctattgtc
agttccttcggaatcccagatgccttccttagcccactcgcttttgactggattgaggca
aatgcacggtcttctgggaatgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348804
Entry
4348804           CDS       T01015                                 
Name
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00592  alpha-Linolenic acid metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4348804
   00592 alpha-Linolenic acid metabolism
    4348804
   01040 Biosynthesis of unsaturated fatty acids
    4348804
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4348804
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4348804
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     4348804
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Other DBs
NCBI-GeneID: 4348804
NCBI-ProteinID: XP_015614832
UniProt: Q94LR9 A3C5F4
LinkDB
Position
10:16775389..16779643
AA seq 461 aa
MEKAINRQRVLLAHLEPAASPAAAAPAITASACAAGDSAAYHRGACFADDVVIVAAYRTA
ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF
YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVNQVRLDGQVNP
KVELFSQARDCLLPMGLTSENVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPV
HTKIVDPKTGEEKEIVVSADDGIRPGTSLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV
LLMRRDIAMQKGLPIVGVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLQIDDVDLFEIN
EAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGARSVSTLLNEMKRRGKDCRFGV
ISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKDAM
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggagaaggcgatcaacaggcagagggtgcttctcgcccacctggagcccgccgcgagt
cccgccgccgccgcgccggccatcaccgcgagcgcgtgcgccgcgggggacagcgccgcg
taccaccgcggggcgtgcttcgcagacgacgtcgtcatcgtcgctgcctataggacagca
atttgcaagtccaagagaggtggtttcaaggatactcccgcagaggacctcttggttcca
gtattcaaggctttgatagataaaacgaagttgaacccaagtgaagttggtgatattgtt
gttggtactgttttagctcctgggtcccaaagggcaattgaatgcagaatggctgcattt
tatgctggattccctgataccgttcctcttatgactgtaaacaggcaatgttcgtctggg
cttcaagcagttgcaaatgttgcttctaacattaaagcaggactttatgacattggtatt
gctgctggcctagagtccatgacagtgaaccaagttcgccttgatgggcaagtgaacccc
aaagttgagctgttttctcaagcacgcgattgccttctcccaatgggcctcacgtccgag
aatgttgcaaaacgatttggcataacacgaatggagcaagaccaggctgctgttgagtcc
cacaggaaggctgcggctgcagctgcttctggtaaattcaaggaagaaattgttccagtt
cacacgaagattgtggatccaaaaactggtgaggaaaaggagatagtggtctcggcagat
gatggaatccgaccaggcacttcattggcagtcctgtcaaaactcaaaccagcattctct
aaagatggcaccactactgctggaaacgctagccaagtaagcgatggtgctggagcagtc
ttactaatgagacgtgacattgctatgcaaaagggtcttccaatagttggcgtcttcagg
agctttgcagcagttggagttgatccagctataatgggtgttggtcctgctgttgccatc
cctgcggcagtgaaagctgctggtcttcaaatagatgatgttgaccttttcgagattaat
gaggcctttgcatcacagtacgtatactgctgcaagaagttgggacttgatcctgcaaaa
gttaacgttaacggaggtgcaatggctcttgggcatccattgggtgctacaggtgcacgg
tctgtcagtacccttctcaacgaaatgaagcgacggggcaaagactgtcgatttggtgtg
atttccatgtgcataggttctggcatgggggctgctgctgtctttgagcgtggggatgca
gtggatgagctcactaatgctcggtgcatcccgacccataaccggctttcgaaggacgcc
atgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350881
Entry
4350881           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4350881
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4350881
   00592 alpha-Linolenic acid metabolism
    4350881
   01040 Biosynthesis of unsaturated fatty acids
    4350881
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4350881
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4350881
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4350881
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-GeneID: 4350881
NCBI-ProteinID: XP_015616488
UniProt: Q2R1G8
LinkDB
Position
11:complement(23354152..23358321)
AA seq 699 aa
MATAASRSGRRRGGGDDEDDRTAAMRRLRVLSLHLQDPSPSSEAGLAPAACAAAGRRRAT
GGADAAAALAAYLRGRHRDTQARVFEFFLSRPDLQTPVEMSTAAHRELCFRQLCALVREA
GVRPLSLMANDPAEYFAVMEAAGGADISLGVKLGVQYSLWGGSIINLGTKKHRDRFFDGI
DNLDYPGCFAMTELHHGSNVQALQTTATFDPVTDEFIINTPNDGAIKWWIGNAALHGKFA
TVFARLILPLQGKGGDPADMGIHAFIVPIRDLDTNAVLPGIEINDCGHKIGLNGVDNGAL
RFRSVRIPRDNLLNRFGDVSRDGKYTSSLPTINKRFAATLGELVGGRVGIAYSSVGILKV
SVTIAVRYALLRQQFGPPKKPEISVLDYQSHQHKLMPMLASSYAFHFATRYLVDKYSEMK
KTNDEDVMADVHVLSSGLKAYITSYTAKSISVCRESCGGHGYAAVNRFGALRNDHDIFQT
FEGDNTVLLQQVAGDLLKQYQEKFKGGTLSATWNYLRDSMGTYLSQPNPVTSRWEGEDHL
RDPNFQLDAFRYRTSRLLHSVAARLQKHSKTLGGFGAWNRCLNHLLTLAESHIESVILAK
FIEAVKRCPDEKTRELLKLVCDLYALDRIWKDIGTYRNVDYVAPNKAKAIHKLADYLSYQ
VRLVAQELVDAFDLPDLIIRAPIGMQSEAYAQYTQHVGF
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggccaccgccgcctcccgctccggccgccgacgcggcggcggagacgacgaagacgac
cggacggcggcgatgcgacggctgcgcgtgctgtccctccacctgcaggatccgtccccc
tcgtcggaggcggggctggcgcccgcggcgtgcgcggcggcggggaggcggcgggcgacg
gggggagcggacgcggcggcggcgctggcggcgtacctgagggggaggcaccgggacacg
caggcgcgggtgttcgagttcttcctctcgcggcccgacctccagacgcccgtcgagatg
tccaccgccgcgcaccgggagctctgcttccggcagctgtgcgcgctggtgcgggaggcc
ggggtgcgcccgctcagcctcatggcgaacgaccccgccgagtacttcgccgtcatggag
gccgccggcggcgccgacatctccctcggcgtcaagctcggcgtccagtacagcctttgg
ggaggttctataataaatctgggaaccaaaaagcacagagataggttctttgacggaatc
gacaatttggattatcctggctgttttgctatgacagagctgcaccatggatctaatgtc
caggccctacaaactactgctacattcgatccagttactgatgagttcattatcaataca
cccaatgatggagctattaagtggtggattggtaatgcagcacttcatggaaaattcgct
actgtttttgcaaggttaattttgcccctccaaggaaaaggtggggaccctgctgatatg
ggcattcatgcattcattgttcccatacgggaccttgacaccaatgctgttcttcccgga
attgagatcaatgattgtggtcacaagataggcctgaatggtgtggacaatggtgcactg
aggttccgttcagtgaggatacctcgtgataatcttctgaaccgattcggagacgtgtca
cgagatggaaaatacacaagcagtctgccaacaattaacaaaagatttgcagcaaccctt
ggtgagcttgttgggggacgcgttggtattgcatatagttctgtaggtatactcaaagtt
tcagtgaccattgctgttaggtatgctctgcttcgacagcaatttggtccacctaagaag
cctgaaatcagtgtgttggactaccaatctcaccagcataagctaatgcccatgttggca
tcatcatacgcatttcactttgccacacggtacttggtggataaatactcagaaatgaag
aaaaccaatgatgaggatgttatggctgatgtgcatgttctttcatctggattgaaagcc
tacataacttcatatacagccaaatccattagcgtatgccgagaatcatgtggtggccat
gggtatgctgctgtaaatcgttttggtgctttgcgcaatgatcatgatatatttcagaca
tttgaaggagataatacagttcttcttcagcaggttgctggagatctcctgaagcaatac
caggaaaaatttaagggagggacactctcagccacctggaactacttgagggactccatg
ggcacctacctgtcccagccgaatcctgtcacttctcgatgggaaggggaagaccatcta
cgggatcccaactttcagctggatgcattcagataccgaacatctcgattactgcacagc
gttgccgctcgactccagaagcatagcaagacgcttggaggatttggtgcatggaataga
tgtttaaaccatctgctcacacttgcggaatcacacattgagtctgtcattcttgcgaag
tttatagaagcggtcaaaagatgcccggatgaaaaaacacgggaattgttgaaattggtg
tgcgacctttacgcgcttgataggatctggaaagatataggaacctatcggaatgtggac
tatgttgccccaaacaaagccaaggctatccataaactagctgactacctcagttaccaa
gtgaggcttgtcgctcaggaactcgtcgatgcatttgatcttccagatctcatcattcgt
gccccaatcggcatgcagtctgaggcatatgctcagtatactcagcatgttggtttttaa

DBGET integrated database retrieval system