KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324066
Entry
4324066           CDS       T01015                                 
Name
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4324066
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     4324066
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh DXP_synthase_N
Other DBs
NCBI-GeneID: 4324066
NCBI-ProteinID: XP_015615261
UniProt: A0A0P0UYV9 Q9LGL5
LinkDB
Position
1:complement(3136161..3140222)
AA seq 597 aa
MDTTIGSVPTASDAAAPAPAANSAPREATLGRHLARRLAEVGARDVFTVPGDFNLTLLDE
LEAEAGAGHGGVRLVGCCNELNAAYAADGYARARGGGVGACAVTFTVGGLSAINAVAGAF
SENLPVVCIVGGPNSNDYGSNRILHHTIGLPDFTQELRCFQTVTCYQAVVNNLEDAHEQI
DAAISTAIKESKPVYISISCNLPSIPHPTFSRHPVPFFLSPRLSNQMNLEAAVETAAAFL
NKAVKPVLVGGPKMRVAKACKSFVELADACGYPVAVMPSAKGLVPEHHPRFIGTYWGAVS
TPFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVQPDRVVIGHGPAFGCVLMK
DFLHALSARLKKNTAAYENYRRIYVPPGEPPLSEPGEPLRVNVLFQHIQKMLSANSAVIA
ETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAKAAKDKRVIACIGDGSFQVT
AQEVSTMLRWGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGVVEAFHNGEGKCYTA
KVRTEEELKEAIEEAQGPKKDCLCFIEVIVHKDDTSKELLEWGSRVSAANSRPPNPQ
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggacaccacgatcggctcggtgccgacggcctccgatgcggcggcgcctgcccccgcg
gcgaactccgcgccgagggaggccacgctggggcggcacctcgcgcggcggctggcggag
gtcggggcgcgcgacgtgttcacggtgccgggggacttcaacctcacgctgctcgacgag
ctcgaggcggaggcgggggcggggcacggcggggtgcggctcgtcgggtgctgcaacgag
ctcaacgcggcgtacgccgccgacgggtacgcccgcgcgcgcggcggcggggtcggggcg
tgcgccgtcacgttcaccgtcggtggcctcagcgccatcaacgccgtcgccggcgcgttc
agcgagaacctccccgtggtgtgcatcgttgggggccccaacagcaacgactacgggagc
aaccgcatcctgcatcacaccatcgggctgcctgatttcacgcaggagctcaggtgcttc
cagactgtcacttgctatcaggcggtggtgaacaacttggaggatgcacatgagcagatt
gatgctgccatctccactgcaataaaggagagcaagcctgtttacataagcatcagctgc
aacctcccctctatcccacatcccacctttagccgccaccctgttcctttcttcctgtcc
ccaagattatcaaaccagatgaacctggaggcagcagtggaaactgctgcagctttcctg
aacaaagcagtcaagccagtcctcgttggtggaccaaaaatgagggtggccaaagcatgc
aaatccttcgtagagctggctgatgcctgtggttatcctgttgcggtcatgccttctgca
aagggtcttgtgccagagcaccatcctaggtttattggcacgtactggggtgctgtgagc
actccattttgtgctgagatcgtcgagtcagctgatgcatatctatttgctggcccaata
tttaatgactacagctcggttggatactcactacttctcaagaaggagaaggccatcatc
gtccagccagaccgggtggtgataggtcatgggcctgcgtttgggtgtgttctgatgaag
gacttcctgcatgcactttcagcacggctgaagaaaaacacggctgcatatgagaactat
cgtcggatttatgtgcctccgggtgaacctcctttgtctgagcctggagagccattgaga
gtgaatgtacttttccagcatattcagaaaatgttgtcagccaactcggctgtcattgct
gagactggagactcttggtttaattgccagaagctaaagctaccagagggctgtgggtac
gaatttcaaatgcaatatggatcaattggttggtcggtaggtgcaactctgggatatgca
aaggctgctaaggataagcgagtcattgcttgcatcggagatggaagctttcaggtgacg
gcacaagaagtgtcgacaatgcttcgttgggggcagaaaagcatcatcttcctcataaac
aatggagggtacaccatcgaggtggagatccatgacggtccttacaatgtcatcaagaat
tggaactacaccggtgtggtggaagcgttccataatggcgaggggaagtgctacacggca
aaggtccgaactgaggaggaactgaaggaagcaattgaagaagctcagggacctaagaag
gattgcttgtgcttcatagaggtgattgtacacaaggatgacacaagtaaggagcttctt
gagtggggctccagagtttctgctgcaaatagccgcccaccaaatcctcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332519
Entry
4332519           CDS       T01015                                 
Name
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4332519
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     4332519
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Other DBs
NCBI-GeneID: 4332519
NCBI-ProteinID: XP_015631876
UniProt: Q10MW3 B7ERZ5
LinkDB
Position
3:complement(10217802..10220754)
AA seq 605 aa
METHIGSVDGAAAAADNGAVGCPASAVGCPMTSARPAPVSAGEASLGRHLARRLVQVGVS
DVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLS
VLNAIAGAYSENLPVICIAGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCHQAVVT
NLEDAHEQIDTAIATALRESKPVYLSISCNLPGLPHPTFSRDPVPFFLAPRLSNKMGLEA
AVEATVEFLNKAVKPVLVGGPKLRVAKAGKAFVDLVDASGYAYAVMPSAKGLVPETHPHF
IGTYWGAVSTAFCAEIVESADAYLFAGPIFNDYSSVGYSFLLKKDKAIIVQPERVIVGNG
PAFGCVMMKEFLSELAKRVNKNTTAYENYKRIFVPEGQPLESEPNEPLRVNVLFKHVQKM
LNSDSAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIAC
IGDGSFQVTAQDVSTMIRCAQNSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIH
NGEGKCWTSKVKCEEELTEAIGMALGEKDCLCFIEVIAHKDDTSKELLEWGSRVSAANSR
PPNPQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggagacccatatcggatccgtggacggggcggcggcggcggcggacaacggcgcggtg
gggtgcccggcgtcggcggtggggtgcccgatgacctcggcgcgccccgcgcccgtgtcg
gccggcgaggcgtcgctgggacggcacctggcgaggcggctggtgcaggtgggcgtcagc
gacgtgttcgccgtgcccggggacttcaacctcacgctgctcgaccacctgatcgccgag
cccgggctgcgcctcgtcggctgctgtaacgagctcaacgccgggtacgcggccgacggc
tacgcccgcgcgcgcggcgtcggcgcctgcgccgtcacgttcaccgtcggcggactcagc
gtgctcaacgccatcgccggcgcgtacagcgagaacctgccggtcatctgcatcgccgga
gggccgaactccaacgactacggcaccaaccgcatcctccaccacaccatcggcctcccg
gacttctcccaggagctccgctgcttccagaccgtcacttgccaccaggcggtggtgacc
aatctggaggatgcgcacgagcagatcgacaccgccatcgcgacggcgctgcgggagagc
aagcctgtgtacctcagcatcagctgcaatctcccagggctgcctcaccccacgtttagc
cgcgaccccgtccccttcttcctcgcccccaggttgagtaacaagatgggtctggaggct
gcggtggaggccactgtcgagttcctgaacaaggcggtgaagccggtgctcgttggcggc
cccaagctgcgtgtggcaaaggcagggaaggccttcgtcgaccttgttgatgccagtggc
tacgcctacgcggtgatgccgtcggccaaggggctcgtgccagagacgcacccccacttc
atcggcacctactggggtgccgtcagcacggccttctgtgccgagatcgtcgagtcggcc
gacgcctacctcttcgcagggccaatcttcaatgactacagctctgtcggctactccttc
ctcctcaagaaggacaaggccataattgtgcaaccggagcgtgtcatcgtcgggaatggc
ccggcgtttgggtgcgtcatgatgaaggagttcttatctgagctggctaagcgcgtcaac
aagaacaccactgcttatgagaactacaagaggatcttcgtgcctgagggccagccgctg
gagagcgagccgaatgagccgctgcgcgttaatgtgctcttcaagcacgtccagaagatg
ctgaacagtgacagtgctgtgattgccgagactggtgactcctggttcaattgccagaag
ctgaagctccctgagggctgcgggtatgaattccaaatgcagtatggttccattggatgg
tcagtgggtgcattgctcggatatgctcagggcgctaaggacaagcgtgtgattgcctgt
attggtgatgggagtttccaggtgacggcacaggatgtgtcaacaatgattcgctgtgca
cagaacagcataatcttcctgatcaacaacggcgggtacaccattgaggtggagatccat
gacggtccatacaacgtcatcaagaactggaactacactggccttgtggatgccatccac
aatggagagggcaaatgctggacttctaaggtgaagtgcgaggaggagctgacggaggcg
atcgggatggcgctgggggagaaggactgcctgtgcttcattgaggtgatcgcgcacaag
gacgacaccagcaaagagctgctggaatggggatcgagggtttctgctgccaactccagg
ccaccaaatcctcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339066
Entry
4339066           CDS       T01015                                 
Name
(RefSeq) pyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339066
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     4339066
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Other DBs
NCBI-GeneID: 4339066
NCBI-ProteinID: XP_015637741
UniProt: Q0DHF6 B7EQR6 A0A8J8Y9J0
LinkDB
Position
5:23058802..23061540
AA seq 605 aa
MELALVGNPSNGVAKPSCNSVGSLPVVSSNAVINPPVTSAAGATLGRHLARRLVQIGATD
VFAVPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSV
LNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINN
LDDAHEQIDTAIATALRESKPVYISVGCNLAGLSHPTFSREPVPLFISPRLSNKANLEYA
VEAAADFLNKAVKPVMVGGPKIRVAKAKKAFAGIAESSGYPFAVMPSAKGLVPEHHPRFI
GTYWGAVSTTFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKREKAVIVQPDRVVVGNGP
AFGCILMTEFLDALAKRLDRNTTAYDNYRRIFIPDREPPNGQPDEPLRVNILFKHIKEML
SGDTAVIAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCI
GDGSFQMTAQDVSTMLRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHN
SDGNCWTKKVRTEEELIEAIATATGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSR
PPNPQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggagcttgccctggttggcaacccttcgaatggcgtggcgaagccgtcgtgcaactcc
gtcggctcgctgcccgtcgtcagctccaacgccgtcatcaacccgccggtgaccagcgcg
gcgggcgccacgctcggcaggcacctcgcgaggcgcctcgtgcagatcggcgccaccgac
gtgttcgccgtccccggggacttcaacctcaccctgctcgactacctcatcgccgagccc
gggctcaagctcatcggctgctgcaatgagctcaacgccgggtacgcggccgacggctac
gcccgcgcccgcggcgtcggcgcctgcgccgtcacgttcaccgtcggtggcctcagcgtg
ctcaacgctatcgccggcgcctacagcgagaacctccccgtgatctgcatcgtcggcggg
cccaactccaacgactacggcaccaaccgcatcctgcaccacaccatcggcctcccggac
ttctcacaggagctccgctgcttccagaccatcacctgctaccaggccgtcattaacaac
ctcgacgacgcgcacgagcagatcgacaccgccatcgcgacggcgctaagggagagcaag
cccgtctacatcagcgtgggctgcaacctggcaggcctctcccacccaacgttcagtcgc
gagccagtgccactattcatctcgccaaggctgagcaacaaggcgaacttggagtacgcc
gtcgaagccgcggcggacttcctgaacaaggcggtgaagccggtgatggtcggtgggcca
aagatccgggtggccaaggcgaagaaggcgttcgccggcatcgcggagtcgagcgggtac
ccgttcgcggtgatgccgtccgcaaagggcctcgtgccggagcaccacccgcggttcatc
ggcacgtactggggcgccgtgagcaccaccttctgcgccgagatcgtcgagtccgccgac
gcctacctcttcgccggcccaatcttcaacgactacagctccgtcggctactccctgctg
ctgaagcgggagaaggccgtcatcgtgcagcctgaccgcgtggtggtcggcaacggcccg
gcgttcggctgcatcctcatgacggagttcctcgacgcgctcgccaagcgcctcgaccgc
aacacgacggcatacgacaactaccgccgcatcttcatccccgaccgcgagccgcccaat
ggccagcccgacgagccactcagggtcaacatcctcttcaagcacatcaaggagatgctg
tctggcgacaccgccgtcatcgccgagaccggcgactcgtggttcaactgccagaagctc
aggctccccgagggctgcgggtacgagttccagatgcagtacggctcaatcggttggtcc
gtcggcgccacgctcggatacgcccaggcggccaaggacaagcgcgtcatctcctgcatc
ggcgacggaagcttccagatgacggcgcaggacgtgtcgacgatgctgcggtgcgggcag
aagagcatcatcttcctcatcaacaacggcgggtacaccatcgaggtggagatccacgac
gggccgtacaacgtcatcaagaactgggactacaccggcctcatcgacgccatccacaac
tctgacggcaactgctggacaaagaaggtccggactgaggaggagctgatagaggcgatc
gcgacggcgacgggcgccaagaaagactgcctctgcttcatcgagatcatcgtgcacaaa
gatgacacgagcaaagagcttctcgagtggggatccagggtctcggctgccaacagcagg
ccgcctaatccccagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339068
Entry
4339068           CDS       T01015                                 
Name
(RefSeq) pyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339068
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     4339068
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Other DBs
NCBI-GeneID: 4339068
NCBI-ProteinID: XP_015637745
UniProt: B9FJL1 Q6AUJ8
LinkDB
Position
5:23065506..23068210
AA seq 605 aa
MELALVGDPSNGVAKPSCDSVGSLPAVSSKAVIHPPVTSAAGATLGRHLARRLVQIGATD
VFAVPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSV
LNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINN
LDDAHEQIDTAIATALRESKPVYISVGCNLAGLSHPTFSREPVPLFISPRLSNKANLEHA
VEAAADFLNKAVKPVMVGGPKIRVAKAKKAFAGIAESSGYPFAVMPSAKGLVPEHHPRFI
GTYWGAVSTTFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKREKAVIVQPDRVVVGNGP
AFGCILMTEFLDALAKRLDRNTTAYDNYRRIFIPDREPPNGQPDEPLRVNILFKHIKELL
SGDTAVIAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCI
GDGSFQMTAQDVSTMLRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHN
SDGNCWTKKVRTEEELIEAIATATGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSR
PPNPQ
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggagcttgccctggttggcgacccttcgaatggcgtggcgaagccgtcgtgcgactcc
gtcggctcgctgcccgccgtcagctccaaggccgtcatccacccgccggtgaccagcgcg
gcgggcgccacgctcggcaggcacctcgcgaggcgcctcgtgcagatcggcgccaccgac
gtgttcgccgtccccggggacttcaacctcaccctgctcgactacctcatcgccgagccc
gggctcaagctcatcggctgctgcaacgagctcaacgccgggtacgcggccgacggctac
gcccgcgcccgcggcgtcggcgcgtgcgccgtcacgttcaccgtcggtggcctcagcgtg
ctcaacgccatcgccggcgcctacagcgagaacctccccgtgatctgcatcgtcggcggg
cccaactccaacgactacggcaccaaccgcatcctgcaccacaccatcggcctcccggac
ttctcacaggagctccgctgcttccagaccatcacctgctaccaggccgtcattaacaac
ctcgacgacgcgcacgagcagatcgacaccgccatagcgacggcactaagggagagcaag
ccagtgtacatcagcgtgggctgcaacctggcgggcctctctcacccgacgtttagccgc
gagccagtgccgttgttcatctcgccaagattgagcaacaaggcgaacttggagcacgcc
gtcgaagccgcggcggacttcctgaacaaggcggtgaagccggtgatggtcggggggcca
aagatccgggtggccaaggcgaagaaggcgttcgccggcatcgcggagtcgagcgggtac
ccgttcgcggtgatgccgtccgccaagggcctcgtgccggagcaccacccgcggttcatc
ggcacgtactggggcgccgtgagcaccaccttctgcgccgagatcgtcgagtccgccgac
gcctacctcttcgccggcccgatcttcaacgactacagctccgtcggctactccctgctg
ctgaagcgggagaaggccgtcatcgtgcagcccgaccgcgtggtggtcggcaacggcccg
gcgttcggctgcatcctcatgactgagttcctcgacgcgctcgccaaacgcctcgaccgc
aacacgacggcgtacgacaactaccgccgcatcttcatccccgaccgcgagccgcccaac
ggccagcccgacgagccactcagggtcaacatcctcttcaagcacatcaaggagttgctg
tccggcgacaccgccgtcatcgccgagaccggtgactcgtggttcaactgccagaagctc
aggctccccgagggctgcgggtacgagttccagatgcagtacggctcgatcgggtggtcc
gtcggcgccacgctcggctacgcccaggcggccaaggacaagcgcgtcatctcctgcatc
ggtgacggtagcttccagatgacggcgcaggacgtgtcgacgatgttgcggtgcgggcag
aagagcatcatcttcctcatcaataatggtgggtacaccatcgaggtggagatccacgac
gggccgtacaacgtcatcaagaactgggactacaccggcctcatcgacgccatccacaac
tctgacggcaactgctggacaaagaaggtccggactgaggaggagctgatagaggcgatc
gcgacggcaacgggcgccaagaaagattgcctctgcttcatcgagatcatcgtgcacaag
gatgacacgagcaaagagcttctcgagtggggatccagggtatcggctgccaacagcagg
ccgccgaatccccagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344382
Entry
4344382           CDS       T01015                                 
Name
(RefSeq) pyruvate decarboxylase 3
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4344382
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     4344382
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Other DBs
NCBI-GeneID: 4344382
NCBI-ProteinID: XP_015646176
UniProt: Q0D3D2
LinkDB
Position
7:29489913..29491989
AA seq 587 aa
MESNGGGGGSPKEAAVVVPSSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAE
PGLRVVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVG
GPNSNDYGTNRILHHTIGLPDFSQELRCFQPLTCYQAVVNNLDDAHDQIDRAISTAIRES
KPVYISVSCNLPAVPHPTFSRDPVPYFLSPRLSNQASLHAALDATLAFLDKAVKPVLVAG
PKLRVAKAGGAFVDLADASGHAVAAMPSAKGLVPETLPRFIGTYWGAVSTAFCAEIVESA
DAYLFAGPIFNDYSSVGYSCLLKKEKAVVVQPDRVTVGNGPAFGCVMMRDFLSELAKRVR
KNTTAFDNYKRIFVPEGQLPECEAGEALRVNVLFKHIQRMIGGTEIGAVMAETGDSWFNC
QKLRLPEGCGYEFQMQYGSIGWSVGALLGYAQAVQKRVVACIGDGSFQVTAQDVSTMLRC
GQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVNAIHNGEGRCWATRVRCEEELEA
AIATATGDKADSLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggagagcaacggcggaggaggaggatctcccaaggaggcagcggtggtggtgccgtcc
tccggcgacgccaccctgggcgggcacctggctcggcgcctcgtgcaggtgggcgtgagc
gacgtgttcgccgtgccgggggacttcaacctgacgcttctggaccacctgatcgccgag
cccgggctccgcgtggtgggctgctgcaacgagctgaacgccggatacgcggccgacggg
tacgcgcgggcccgtggcgtgggcgcctgcgccgtgaccttcaccgtgggcgggctgagc
gtgctgaacgccatcggcggggcgtacagcgagaacctgccgctgatctgcatcgtgggg
ggccccaactccaacgactacggcaccaaccgcatcctccaccacaccatcggcctcccg
gacttctcccaggagctccgctgcttccaacccctcacctgctaccaggccgtcgtcaac
aacctcgacgacgcccacgaccagatcgaccgcgccatctccaccgccatcagggagagc
aagcccgtctacatcagcgtcagctgcaacctccccgccgtcccccaccccaccttctcc
cgcgacccggtgccctacttcctctccccgaggctctccaaccaggccagcctccacgcc
gcgctcgacgccaccctcgccttcctcgacaaggccgtcaagcccgtcctcgtcgcgggg
cccaagctccgcgtcgccaaggccggaggggccttcgtggacctcgccgacgccagcggc
cacgcggtggccgccatgccgtccgccaaggggctggtgccggagacgctgccgcgcttc
atcgggacctactggggcgcggtcagcacggccttctgcgcggagatcgtggagtccgcg
gacgcctacctgttcgcggggcccatcttcaacgactacagctccgtggggtactcgtgc
ctgctgaagaaggagaaggcggtggtggtgcagcccgaccgcgtgaccgtcggcaatggc
cccgcgttcgggtgcgtgatgatgagggacttcctgtcggagctggccaagcgcgtccgg
aagaacacgacggcgttcgacaactacaagaggatcttcgtgccggagggacagctgccg
gagtgcgaggccggggaggcgctgcgggtgaacgtgctgttcaagcacatacagaggatg
atcggtggcacggagatcggggcggtgatggcggagacgggggactcgtggttcaactgc
cagaagctgcggctgcccgagggttgcgggtacgagttccagatgcagtacggctccatc
gggtggtcggtgggggcgctgctgggctacgcgcaggctgtccaaaaacgggtggtggct
tgcatcggcgacggcagcttccaggtgacggcgcaggacgtgtcgacgatgctgcgttgc
gggcagcggagcatcatcttcctcatcaacaacggcgggtacaccatcgaggtggagatc
cacgacgggccgtacaacgtgatcaagaactgggactacgtgggcctcgtcaacgccatc
cacaacggcgaggggcggtgctgggccacccgggtgcggtgcgaggaggagctggaggcg
gccatcgcgacggccacgggggacaaggcggacagcctctgcttcatcgaggtggtggcg
cacaaggacgacaccagcaaggagctcctcgaatggggctccagagtctccgccgccaac
tccaggccgcccaacccgcagtag

DBGET integrated database retrieval system