KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324149
Entry
4324149           CDS       T01015                                 
Name
(RefSeq) DNA ligase 3
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4324149
   03410 Base excision repair
    4324149
   03420 Nucleotide excision repair
    4324149
   03430 Mismatch repair
    4324149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4324149
   03400 DNA repair and recombination proteins [BR:osa03400]
    4324149
Enzymes [BR:osa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     4324149
    6.5.1.6  DNA ligase (ATP or NAD+)
     4324149
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     4324149
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    4324149
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     4324149
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     4324149
   NER (nucleotide excision repair)
    Other NER factors
     4324149
   MMR (mismatch excision repair)
    Other MMR factors
     4324149
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL UBA_4 RMMBL Lactamase_B_2 Choline_bind_3
Other DBs
NCBI-GeneID: 4324149
NCBI-ProteinID: XP_015621918
LinkDB
Position
1:complement(28261218..28273193)
AA seq 1404 aa
MAYLFSSPDSKSLSVATSTLFLSSLASLPSPHSEPPSASAASPLSPVPASVPPTALIPGS
RFLVDAFRHAGDFTASYFLSHFHSDHYTGLGPSWRRGLVFCSPLTARLLVSVLSVPPQLV
VVLDAGVRVTVDGWCVVAVDANHCPGAVQFLFRSSGPNAERYVHTGDFRFSQSMITEPNL
LEFIGADAVFLDTTYCNPKFTFPPQKESLEYVVNSIKRVKEESRASGERVLCLIATYVVG
KERILLEVARRCGCKIHVDSRKMEILTLLGIGGEDGVFTEDAAATDVHVTGWNILGETWP
YFRPNFVKMKEIMVERGYNKAVGFVPTGWMYETKKEGFAVRTKDSLEIHLVPYSEHSSYN
ELRDYVKFLHPKRVIPTVGLDGGKLDSKEAFALQKHFAGLVDETANKQEFLMAFHRSSRN
ATLGPEDAVTGLSQQEGEVQELEEATLLPASLAFERSDSFQEKITVEMKKELSDFLPSWV
SQDLILDLLIKSGGDVVQAATDFFEKERDFFEEANVYNSETPKSEIDLSSDHGSSADASS
QQEVPLFSQKPMDHSSKLLNLNAMRMKSNLSKRERKRGSNSADKPKKKGRSTAFKPLTES
SGRKQSTITNYFARTMLAASKSDTSDKVTVDANQNNVRNDDQFTEVVESEKQSVSQLLQI
VDGGMSRESAISLLEKAKGDVNVAVDIFYSKTDNSNVLENDMNIVTQNTENEMTDKSSST
GLLRNSSEATPKMPNLCVQSYVAQADSVCISLPIEKYLPIEHACWTAGQPAPYLHLARTF
DLVEREKGKIKTTAMLCNMFRSLLALSPDDVLPAVYLCTNKISPDHENIELNIGGSLVVS
ALEEALGSSRSKIHEMYKTFGDLGDVAQECRQNQMLLAPPRPLSIRDVFSTLRKLSGIAG
SGSTGRRKILVLHLIRSCREMEMKFLVRTLVRNLRIGVMMKTILPALAHAVVIDGKYSNS
PVLSLEGIKPQLQELSTEVAEAYNVIPNLDLLIPSLLREDTAFSASSLAMITGTPIPPML
ARITNGLTQSLKLFNGRAFTCEYKYDGQRAQIHRSNDGSVQIFSRQMKESTSRFPDLVGM
IKELCSIEVSSFILDAEVVGIDRKKGNKLMSFQELSSRERGSKHSSIAIQNIKVDICVFV
FDIMFCNGQSLLNCSLRQRRKYIHDLFQEKPGHFELAQQLTVEADEASVDNSTTLERMNT
FFKMACQSSCEGIMLKILDVDAGYSASKRCDSWLKVKRDYVGLGDSLDLVPIGAWYGNGR
KAGWYSPFLMACYNPEYEEFQSVCRVMSGFSDEFYKEMKEFYSGDRILPKKPVYYKTDEL
PELWFSAEQVWEIRGADLTLSPVHHAAIGLVHPSRGISVRMPRYIRSRPDRSPEDCSTAT
DVASLFKAQTRKMEVSSDGQDTSH
NT seq 4215 nt   +upstreamnt  +downstreamnt
atggcgtacctcttctcctccccggactccaaatcgctctccgtcgccacctccaccctg
ttcctatcgtcgctcgcctccctcccttccccccacagcgagcccccttccgcctccgcc
gcatcgccgctctctcccgtccccgcctccgtgccgcccacggcgctcatcccgggctcc
cgcttcctcgtcgacgccttccgccacgccggcgatttcaccgcctcctacttcctctcc
cacttccactccgaccactacaccggcctcggcccctcgtggcgccgcggcctcgtcttc
tgctccccgctcaccgcgcgcctcctcgtctcggtgctctccgtgccgccgcagctcgtc
gtcgtgctcgatgctggcgtccgcgtcaccgtggatgggtggtgcgtcgtcgctgtggat
gctaaccattgccccggtgccgttcaattcctcttccgctcatctggaccaaatgcggag
aggtatgtccacacgggcgacttccggttttcgcagtctatgataaccgaacctaatttg
ctggagttcatcggtgctgatgctgtgtttctagataccacgtactgcaatcccaaattt
acgtttcctccacaaaaggagtcactggagtatgtcgtgaactcaatcaagcgggtgaag
gaggagagcagagcatctggagagcgcgtgctgtgtttgatcgcgacctacgtggtgggc
aaggagaggattttgctggaagttgcacgacgctgtggctgtaagatccatgtggacagt
aggaagatggaaatcctgactctattggggattggtggggaggatggagtttttactgag
gatgctgcagcaacagatgtgcatgtcactgggtggaatattttaggtgaaacatggccc
tattttcggccaaattttgtgaagatgaaggagatcatggtggagagaggatataacaag
gctgttggatttgtaccgaccggttggatgtacgagaccaagaaggaaggctttgcagtt
agaacaaaggattcacttgagatccatcttgtgccttatagcgagcactcgagctataat
gagttgcgggactacgtgaagttcttgcacccaaaacgggtaattccaaccgtggggctt
gatggtggaaagctcgatagtaaagaggcatttgctctgcagaagcattttgctggtttg
gtggatgagacagcaaacaaacaggagttcctgatggcattccaccgaagctcaagaaat
gctactcttggccctgaggatgcagttactggattgagccagcaagaaggggaggtgcaa
gaactggaggaggctactttgttacctgcaagtttggcttttgaacgatcagatagtttt
caagagaagattacagtggaaatgaagaaagaattatcagatttcctaccctcatgggtc
agccaggacctgatcctggacttgctaattaagtcaggcggtgatgttgttcaagcagca
actgatttttttgagaaagaaagagatttctttgaggaagcaaatgtttataatagtgaa
acgcctaagtcagagatagatctctcttctgatcatggatcttctgctgatgcaagtagt
cagcaagaagttcctttattttcacagaagcccatggatcattctagtaagttgctgaat
ttgaacgctatgagaatgaagtcaaatctttctaaaagggaaaggaagaggggctctaat
tctgcggacaaaccaaaaaagaaagggcggtcaactgcctttaaacccttgacagaatcc
agtgggcgcaaacagtccacaattacgaactattttgctagaaccatgctagctgcttct
aaaagcgatacatccgataaagtaactgtagacgcaaatcaaaacaatgtgaggaatgac
gaccagtttactgaagttgtagagtcagagaagcagagtgtaagccagcttcttcagatt
gtcgatggtggaatgtccagagagtctgcaatttcattgcttgagaaggcaaaaggggat
gtgaatgtagcagttgatatattttacagtaaaaccgacaacagtaatgtacttgaaaat
gatatgaatattgtcacacaaaacacagaaaatgaaatgacagacaaatctagtagtacg
ggcttgcttcgcaactcttctgaggccactccaaagatgccgaacttatgtgtacaatct
tatgtggcacaagcagattcagtctgtatatcattgccaattgaaaagtatctaccgatc
gagcatgcttgctggacagcaggacagcctgcaccatacttacatttggctcgcactttt
gatctggttgaaagagaaaagggaaagatcaaaactactgccatgctttgcaacatgttc
cgaagtttgcttgccttatcacctgatgatgtgctacctgctgtttatttatgtactaat
aaaatttctcctgaccatgaaaatattgaactaaacattggtgggagtttggttgtatct
gctctggaggaggcattaggatccagcagatctaaaatacatgagatgtacaaaacgttc
ggcgatcttggtgatgttgcccaagaatgccgccagaatcaaatgttacttgctcctcct
cgtcccctctcaattcgcgatgtgttttccacacttcgcaaactaagtgggatagcaggt
agtgggagtactggaaggagaaaaattcttgtcttgcatcttatccgttcttgcagagaa
atggagatgaaatttcttgttagaacactggtccgtaacttgcgtattggggtcatgatg
aagacaattttacctgcacttgcacatgctgttgttatagatggaaaatattcaaatagt
cctgtgctatctttggaaggcataaaaccacaattacaggaactttcaactgaagttgct
gaagcatacaatgtcattcctaatcttgatttgcttattccctctctcctgagagaagac
actgcattttcagcctcgtccttagcaatgataactggcacccctatcccacctatgctt
gcaagaattactaacgggttgactcaatcactgaaattgtttaatggtagagcatttacc
tgtgagtacaagtatgatggtcagcgagcccagattcacagatcaaatgatggatctgtg
caaatattttcaaggcaaatgaaagagtcaacctctcgatttcctgatctggttggcatg
atcaaagagctgtgcagcatcgaagtatccagctttatacttgacgccgaggttgtggga
atcgataggaagaaaggaaacaaactgatgtcattccaagagctgtcttcaagagagaga
gggagcaagcactcctcaattgcaattcagaacataaaggtagacatttgtgtgtttgtt
tttgatatcatgttctgcaatggacaaagcctattgaactgctcacttcggcaaagaaga
aagtacatccacgacttgttccaggagaagccaggacattttgagttagctcagcaactt
actgtagaagcagatgaagcttctgtggataattctaccactttggagagaatgaacacc
tttttcaaaatggcatgccagtcttcttgtgagggtattatgctgaaaatactggatgtt
gatgctggatattctgcttccaagcgctgtgattcatggttaaaggttaagcgtgactat
gttggcttgggtgatagcctggacttggttccaattggtgcatggtatggaaatggtcgg
aaagctggatggtatagcccttttcttatggcgtgctacaaccctgaatacgaagagttc
caaagtgtctgccgcgttatgtctggtttctcagatgagttctataaagagatgaaggag
ttctattctggcgacagaatactgcccaagaaacctgtttactacaaaacagacgagctt
ccggagttgtggttttctgcggaacaggtttgggaaatccgaggtgcagacctcacgcta
tcccctgttcaccatgcggctattggtctggtccatccgtcgcgtgggatctcagtgagg
atgccgaggtacatacgctctcgtccagatcggagtccagaggattgtagcacggctact
gatgttgctagcttgttcaaagctcagacccggaagatggaggtcagcagcgatggccag
gacacaagtcactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348965
Entry
4348965           CDS       T01015                                 
Name
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4348965
   03410 Base excision repair
    4348965
   03420 Nucleotide excision repair
    4348965
   03430 Mismatch repair
    4348965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4348965
   03400 DNA repair and recombination proteins [BR:osa03400]
    4348965
Enzymes [BR:osa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     4348965
    6.5.1.6  DNA ligase (ATP or NAD+)
     4348965
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     4348965
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    4348965
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     4348965
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     4348965
   NER (nucleotide excision repair)
    Other NER factors
     4348965
   MMR (mismatch excision repair)
    Other MMR factors
     4348965
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase eIF-3c_N TrmB
Other DBs
NCBI-GeneID: 4348965
NCBI-ProteinID: XP_015614473
LinkDB
Position
10:complement(18552940..18559660)
AA seq 916 aa
MFLLRATATSTSTAASAAAASLLLRCHHPLSPPPRTLALALPARPPPALLLPSRFRLSSS
ASSSSRRRATGAASASAGAGAGKGKGKGGKSSGGKAAAAAAAGGAAMSASAGGGGGGGGK
RTVADVLMGNARDAARKAKKGAAPSPKKLKTQPQPAAEADGGAVAKPEEKPHSPVKPKRS
SSPTKSNSPGEGKRSESVAAGAKPEAKEKPSPKKPKTLGAKSDTKSSAEGVEKEKRRSPS
PTKAKALASESQDIKKPSSPKKTKALDAPKSEEKDTTLELKKKGSEFNPMAAAYWSPEEP
VPFLFLARALDLISNESGRIVITEILSNVFRTVIATTPEDLLATVYLSANRIAPPHEGTE
LGIGDASIIRALAEAYGRREEHVKKNLKELGDLGLVAKASRLSQKMMYKPKPLTISHVLA
KFRTIAKESGKDSQDKKRNHIKGLLVAATDCEPQYITRLLQSKMRIGLAEKTVQMALGQA
AVYSEKHSPPSKIQSPFEEAAKIIKQVYSVLPIYDKIVPAILEVGVWKLPEICSFSIGVP
VGPMLAKATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCLEDGSVEIYSRNAERNTGKYP
DVVDAVSRFRKPTVKSFVLDCEIVAYDREKKKILPFQILSTRARKGVTISDIKVSVCTFG
FDILYINGKPLLQEQLKVRREHLYNSFEEVPGVFQLATSITSNDLEEIQKFLDTAVNSSC
EGLIIKTLDKDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGSFL
LACYDEQNEEYQTICNIGTGFSEQQLEERSVSLRTKAIPKPKAYYRFADTMDPDVWFEPS
EVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLRVRDDKNPEQATTSEQVADMYRA
QKIYHANNNNDDEDDD
NT seq 2751 nt   +upstreamnt  +downstreamnt
atgttcctcctccgcgccaccgccacctccacctccaccgccgcctccgccgccgccgcc
tcgctcctcctccgatgccaccacccgctctccccgccgcctagaaccctagccctcgcc
ctccccgctcgccctccccccgccctcctcctcccctcccgcttccgcctctcctcctcc
gcgtcctcctcctcccgacgccgcgcgaccggtgccgcatccgcatccgcgggcgcgggc
gcggggaaggggaaggggaaggggggcaagtccagcggggggaaggcggcggccgcggcg
gcggcgggaggagcggccatgtcggcctcggcgggtgggggtggaggtgggggagggaag
cggacggtggcggatgtgctgatggggaacgcgcgggacgcggcgaggaaggcgaagaag
ggggcggcgccgtcgccgaagaagctgaagacgcagccccagcccgccgcggaggcggat
ggcggcgcggtggcgaagccggaggagaagccgcattcgccggtgaagcccaagcggtcg
tcctcgccgactaagtccaactcgccaggtgaggggaagaggtccgaatcggtggctgct
ggcgcgaaaccggaggcgaaggagaagccctcgccgaagaagcctaaaaccctaggtgcc
aaatccgacaccaagtcctccgcggaaggcgttgagaaggagaagaggaggtcaccatct
ccgacgaaggcaaaagcgctagcttctgaatcccaggacataaagaagccctcctcacct
aagaagaccaaagccttggatgcccccaagtctgaggaaaaggacaccaccctcgagctc
aagaagaagggcagtgaattcaatcccatggctgctgcttattggagccccgaggagccc
gtgccgttcctgttcctcgctcgggcacttgacctcatctctaatgagtctggaaggatt
gttatcacggagatcctatcgaatgtattccgcacggtgattgccacaacaccagaggat
ctcctcgcgacagtatacctctcagccaaccggattgcgccgcctcatgaagggactgaa
cttggaattggggatgcatcaattatccgtgcacttgcggaggcatacggccgcagagag
gagcatgtcaagaagaacctaaaggagttgggcgatttggggcttgttgcaaaagcaagc
aggttgtcacagaagatgatgtacaaaccgaaaccactgacgatctcacatgtacttgca
aaattccggacaattgcaaaggaatcaggcaaagatagtcaagataagaaaagaaatcat
atcaaaggacttctcgttgccgcaactgactgtgaacctcaatacattacacgactactt
cagtcgaagatgaggattgggttagcagaaaaaaccgtccagatggctcttgggcaagct
gctgtgtattctgaaaaacattctccaccgtcaaaaatccaatccccttttgaagaggct
gcaaaaataattaaacaagtatattcagttcttccaatatacgataaaattgtcccagct
attctagaagttggtgtttggaaacttccagagatatgcagtttttctattggtgttcct
gttggtcctatgttggcaaaagcaacaaagtctgtctcagagatcatagacaaatttcag
ggtcttgagtacacttgtgagtacaagtatgatggtgaacgggctcagatacattgcctg
gaagatggatcagtagagatctatagtcgtaatgctgagaggaacactgggaagtatcct
gatgttgttgatgcggtttctagattccggaagcctacagtcaaatcatttgtcttggac
tgtgaaattgttgcttatgaccgtgaaaagaagaaaatattaccttttcagatacttagc
acacgggcccgcaagggtgttaccataagtgatatcaaagtgtcagtctgtacttttggc
tttgatattctttacatcaatggcaagcctcttctccaggaacaactgaaagttcgacga
gagcatctttacaactcctttgaggaagtaccaggtgtttttcaattggcaacttcaatt
acatcaaatgacctcgaggagatacaaaaatttcttgacacagctgtcaactccagttgt
gaagggttgattatcaagacattggataaggatgctacatatgagccagcaaaacgatcg
aacaattggttgaaattgaagaaagactacatggacagcattggagactctttggatttg
gtgccaattgctgcctttcatgggagaggaaaacgtacaggtgtatatggatcattcctc
ctggcatgttacgatgagcagaacgaagaataccaaacaatctgcaacataggcactgga
ttttctgagcaacagcttgaggagcgttctgtgagccttcgaactaaagcaataccaaaa
ccaaaggcatactataggtttgctgacacaatggacccagatgtgtggtttgagccttca
gaggtttgggaggtgaaagctgctgatttgagcattagtcctgtgcatcgtgctgccaat
ggtatagttgatccgaacaagggcatctccctaagatttcctcgcttgttacgtgttcgt
gatgataaaaatccagaacaggcaaccacatctgagcaagttgctgatatgtaccgtgca
caaaagatataccatgcgaacaacaataacgatgatgaggatgatgactag

DBGET integrated database retrieval system