KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324174
Entry
4324174           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 2A
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4324174
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324174
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4324174
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4324174
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4324174
SSDB
Motif
Pfam: P34-Arc Trns_repr_metal
Other DBs
NCBI-GeneID: 4324174
NCBI-ProteinID: XP_015612421
UniProt: B9EYD9
LinkDB
Position
1:26527458..26532049
AA seq 320 aa
MILLQSPSRFLLQILQDRVLSGDKGVDIDCHTVEFDDVRYHIQFSMRNPKVMVLSVALPL
PPPEAMLYDGLPLGAIEAIKAAYGPVVQILDPPKDGFDLTMKINLTKLPPDEEQRNAVLT
QIASVREVVLGAPLKLLLKHLASKTVAPNVDKLVALVHRPNESFFVAPQADKVTVVYPMR
FQDSIDIVLATSFLQEFVEARRTSALNNAPSCLWSPVPPLELKGVPSDALNANAGFVTFV
VFPRHVEGKKLDKTVWSLLTFHAYVSYHVKCSEGFMHTRMRRRVETLIQALDRAKSDAEK
LKKLVNGGSFKRLSLNNDGN
NT seq 963 nt   +upstreamnt  +downstreamnt
atgatacttctccagtcgccgtccaggttcctgctccagatcctgcaggatcgcgtcctc
agtggcgacaagggcgtggacatcgattgccacacggtggaattcgacgatgtgcggtat
catatccagttttctatgaggaatccaaaggtaatggtgctatcagtagcattgcccctc
ccacctcctgaggccatgctatatgatggacttccacttggtgctatcgaggcaataaag
gcagcttatggaccagtcgttcaaattcttgatcctccaaaggatggctttgatctcaca
atgaagataaacttgacaaagcttccgccagatgaagagcaaaggaatgctgtcttgact
caaattgcatctgtgagagaggtggtgctgggtgcaccactgaaacttctgctgaagcat
ctagcttcaaagacggtggctcctaatgttgacaagcttgttgctcttgttcaccgtcct
aatgaatcctttttcgttgctccccaggcagacaaagttacagtagtataccctatgagg
ttccaggattccattgatatagttttagcaacttcctttctgcaggaatttgtggaagca
aggcggactagcgctcttaacaacgccccttcctgcttgtggtctccagtaccacctctt
gagttaaaaggagtaccttctgatgcactaaatgcaaatgccggttttgttacttttgtt
gttttcccgcggcatgttgagggtaaaaaattggacaaaacagtttggagtttgttgact
tttcatgcttatgtaagctaccatgtgaagtgttctgaaggattcatgcacaccaggatg
agacgtagagttgagacgctgatccaggctttggatcgtgcaaaatctgatgcagagaag
ttgaagaagttggtgaatggtggatctttcaaaaggctgagcttgaataatgacggcaac
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328824
Entry
4328824           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 3
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328824
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4328824
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4328824
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4328824
SSDB
Motif
Pfam: P21-Arc
Other DBs
NCBI-GeneID: 4328824
NCBI-ProteinID: XP_015626361
UniProt: Q6EUK0
LinkDB
Position
2:7643688..7646134
AA seq 174 aa
MVYHSSFVDDTGITKACGCPLLPLKTHIRGPAPAFDQDKADIVDEAITFFRANVFFKNFN
VKSPADKLLIYLTFYINIALKRLEGCRTLAVGTKAIINLGLEKVPVPGEPGFPFPGLFTL
PQSQEEAELLRNYLKQIREETSGRLLNCAYRANGTPNKWWLAFAKRKFMNIVIL
NT seq 525 nt   +upstreamnt  +downstreamnt
atggtttatcactctagctttgttgatgacaccgggattaccaaagcatgcggctgtcct
ttgcttccactaaaaactcatataaggggcccagcgccagcattcgatcaagacaaggct
gacattgttgatgaagcaattacattcttccgagcaaatgtcttcttcaaaaacttcaat
gtgaaaagcccagcagacaagttactgatctatctgacattttacatcaatattgccctg
aaaaggctggaaggttgccgaacactggctgttgggacaaaggcaatcattaatctgggt
ttggagaaagttcctgtgcctggggaaccagggtttcccttccctggtcttttcactcta
ccccaatctcaggaggaagcagaactattgaggaattatctgaagcagataagggaggaa
acaagtggaaggttgcttaactgcgcatacagagctaatggtactccaaacaaatggtgg
ttggcttttgcaaagaggaaattcatgaacattgtcattctttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329867
Entry
4329867           CDS       T01015                                 
Name
(RefSeq) actin-related protein 3 isoform X2
  KO
K18584  actin-related protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4329867
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4329867
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4329867
   04147 Exosome [BR:osa04147]
    4329867
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4329867
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4329867
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4329867
  Exosomal proteins of other body fluids (saliva and urine)
   4329867
  Exosomal proteins of bladder cancer cells
   4329867
SSDB
Motif
Pfam: Actin MreB_Mbl FtsA
Other DBs
NCBI-GeneID: 4329867
NCBI-ProteinID: XP_015623040
UniProt: Q6K908
LinkDB
Position
2:23177413..23182120
AA seq 428 aa
MDAASRPAVVIDNGTGYTKMGFAGNVEPCFITPTVVAVNDTFAGQTRANTTKGNWMAQHS
AGVMADLDFFIGEDALARSRSSNTYNLSYPIHNGQVENWDTMERFWQQCIFNYLRCDPED
HYFLLTESPLTPPETREYTGEIMFETFNVPGLYIACQPVLALAAGYTTTKCEMTGVVVDV
GDGATHIVPVADGYVIGSSIRSIPITGKDVTQFIQQLLKERGEHIPPEESFDVARRVKEM
YCYTCSDIVKEFNKHDREPNKYIKHWSGIKPKTGAKYTCDIGYERFLGPEIFFHPEIYNN
DFTTPLHVVIDKCIQSSPIDTRRALYKNIVLSGGSTMFKDFHRRLQRDLKKIVDARVLAS
NARLGGDAKAQPIEVNVVSHPIQRYAVWFGGSVLASTAEFYEACHTKAEYEEYGASICRT
NPVFKGMY
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacgccgcctcccgccccgccgtcgtcatcgacaacggcaccgggtacacgaagatg
gggttcgccgggaacgtggagccctgcttcatcacccccaccgtcgtcgccgtcaacgac
accttcgccggccagaccagggccaacaccaccaaggggaactggatggcgcagcacagc
gccggcgtcatggccgatctcgacttcttcatcggggaggacgccctggcccgctcccgc
tccagcaacacctacaacctcagctatccaattcacaatggccaggttgagaattgggac
accatggagaggttctggcagcagtgcattttcaattacctgcggtgtgatccggaggat
cactattttctgctcaccgagagccccctgactcctcccgagacccgcgagtacaccggg
gagatcatgtttgagactttcaatgtgcctggtctgtacatagcgtgccagccggttctt
gccctcgcagcaggatacaccaccacaaagtgtgaaatgacaggtgttgtagtcgatgtg
ggtgatggggctacccacattgttcctgttgctgatggttatgttataggaagcagcatc
agatcaattccaattacaggcaaggatgttacccagtttattcagcaactcttaaaggaa
agaggtgagcacattccaccagaagaatcttttgatgtggcaaggagagtgaaagaaatg
tactgctatacatgttcagatattgtgaaggaatttaataagcatgacagagagcccaat
aagtacataaagcactggagtggcatcaaaccaaaaactggtgccaaatacacctgcgac
attggatatgaacgcttcctagggcctgagattttcttccaccctgagatttacaacaat
gacttcaccactcctttgcatgtagttattgacaagtgcatccaatcatccccaattgac
acaagaagggctctttataagaatattgtcttgtccgggggatcaactatgtttaaggat
ttccacaggaggctgcagcgggacctaaaaaagatagtggatgcacgagtccttgcatct
aatgctcgacttggtggagatgcaaaggcccaacctatagaagtaaatgtagttagccat
cctattcaaagatatgctgtctggtttggtggttctgtgcttgcctctaccgctgaattc
tacgaggcttgccacacaaaagcagagtatgaagagtatggcgcaagcatctgccggacg
aatcctgttttcaaagggatgtactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331146
Entry
4331146           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4331146
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331146
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4331146
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4331146
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4331146
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 PD40 eIF2A BNR_3 YqcI_YcgG
Other DBs
NCBI-GeneID: 4331146
NCBI-ProteinID: XP_015623093
UniProt: B9F480 Q6K699
LinkDB
Position
2:complement(35056935..35062543)
AA seq 375 aa
MAAAAIHQFAECITCHAWSPDHSMIAFCPNNNEVHIYKFFTDKWEKLHVLSKHDQIVSGI
DWSRSSNKIVTVSHDRNSYVWTQEGHDWVPTLVILKLNRAALCVQWSPKENKFAVGSGAK
SVCICYYEQDNNWWISKVVRKKHESSVTSVAWHPNNILLATTSTDGKCRVLSTFIKGVDT
RGSHASTSTDWKFGEQIAQLDLSSMWAFGVRWSPSGKTLAYAGHNSMIYFIDDVETSPAA
QNLALRDLPLRDILFLSERTVIGVGFDCNPMIFSADETGLWSFVRYLDERKVTTSTSRAS
QLSEAFGKLYGQSKQVASSDTVEPSKPRGGVHENCITCIVPLRKGNDSIVKRFSTSGLDG
KIVVWDAENHIDIKK
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggccgcggcggcgatccaccagttcgccgagtgcatcacctgccacgcgtggagcccc
gaccactcgatgattgccttttgtccaaacaacaatgaagtacatatctataagtttttt
actgacaagtgggagaaacttcatgttctttcaaagcatgatcaaatagtatctggaata
gattggagtagatcttccaacaagatcgtaacggtctcacatgatagaaattcatatgtt
tggacacaagagggccatgattgggttcctacccttgttattctcaagctaaatcgtgca
gctttatgtgtccagtggagcccaaaagaaaacaagtttgccgtaggaagtggtgctaag
tctgtgtgcatttgctactatgaacaagacaacaactggtggattagcaaggttgttagg
aagaagcatgaatcttctgtcactagtgttgcatggcatccaaacaatatacttcttgca
acaacatcaactgatggtaaatgcagagtgttatccactttcatcaagggtgtcgataca
aggggatcacatgcgagcacttctactgattggaaatttggagagcaaattgctcagctt
gacctatcatctatgtgggcatttggtgtaaggtggtcgccaagtggaaagacactagcc
tatgcagggcacaattccatgatttatttcattgatgatgttgaaacgtctcctgctgca
cagaatttagcactgcgtgatctgcctctccgtgatattctttttctttctgaaaggacg
gtgattggtgttggatttgattgcaatcctatgatcttttctgcagatgagactggactt
tggagctttgtcagatacttggatgaaagaaaagtaactacatcaacttcaagagcttca
cagctatctgaagccttcggaaagctatatggccaatcaaagcaagtggcaagcagtgat
actgttgaaccatcaaagcctcgtggtggtgttcatgagaattgcataacttgcatcgtg
ccattgagaaaaggaaacgacagtattgtcaaacggttcagcacgtcaggattggatggt
aagattgtggtatgggatgcagaaaaccacatcgacattaaaaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334780
Entry
4334780           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 4
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334780
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4334780
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4334780
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4334780
SSDB
Motif
Pfam: ARPC4 Radical_SAM_2 DUF447 MuF_C
Other DBs
NCBI-GeneID: 4334780
NCBI-ProteinID: XP_015628493
UniProt: A3APR3 Q852C5
LinkDB
Position
3:35669627..35672791
AA seq 169 aa
MANTLRLYLTCIRNTLEAAMCLQNFPCQEVERHNKPEVELKTSPELLLNPVLICRNEAEK
CLIETSINSIRISMKVKQADELENILAKKFLRFLSMRAEAFQVLRRKPVQGYDISFLITN
YHCEDMHKHKLIDFIVQFMEDIDKEISELKLSVNTRGRLVATEFLKQFI
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctaatacgctgcgattgtatctcacttgcataaggaacactctggaggctgccatg
tgcctgcagaatttcccttgccaagaggtcgagaggcacaacaaaccggaggtggagcta
aagactagccctgaacttctgctgaacccagtgctcatttgccgtaatgaagcagaaaag
tgtttgatagagacttcaatcaactctattcgtattagcatgaaggtcaaacaggcagat
gagctagaaaatattcttgcaaagaagtttcttaggtttttatcaatgagagcagaagca
ttccaagtgctgaggagaaaaccagttcagggttatgatatcagtttcctgataacaaac
taccactgtgaggacatgcacaagcataagctcatagatttcattgttcagtttatggag
gacatcgacaaggagatcagtgagctaaagctttcggtaaatacacgtggtcggttagtg
gcaactgaattcctgaagcagttcatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336383
Entry
4336383           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 2B isoform X1
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4336383
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4336383
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4336383
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4336383
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4336383
SSDB
Motif
Pfam: P34-Arc
Other DBs
NCBI-GeneID: 4336383
NCBI-ProteinID: XP_015634373
LinkDB
Position
4:complement(25608148..25611254)
AA seq 377 aa
MLCGNSASSMAFFSSGSRALVEILTGLQSVERPMPVDHTLFEFGSIRYHLQASITDSENI
YLSISTPSLSYEASPSSGLPEITLQETRKMYHKFAEIIEPAKEGYTLTLRLNFSGLTRPK
DRTKAINQISLLQSVILSSQLKDMLASLGSSGTMKLVYNQRDPFFVSKTPVKISAIFPMR
FRDDTDLAIASSFFQELQDLGSTSSFSRAPRCSWSPIPPPELRGEYVHHLTTNGGFVSFD
ILARHVKGRRAARTAWILLNFQSYVKYHIKCTRSYIQSRMRKRLEIMTEVIDDAKFRGND
ESSKKLQVRKRSKRRSIKFARAKKLQKGFKAVIDKIKRLRLRIRVKGLDRFRRHCQCFPV
LKLTMAQRKEQKYQKLE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgctatgcggtaacagtgctagctccatggcgttcttcagcagcggatcgcgggcgctg
gtggaaatcctgacgggattgcagagtgttgaacgacctatgcctgttgatcataccttg
tttgagtttggatcaatccgttaccatttacaggcttctattacagattcagagaacata
tacttgtcaatatcaacaccatctctttcttatgaggcttcgccatccagcggcttgcct
gaaatcacattacaggagacaaggaaaatgtatcacaagtttgcagagatcatcgagcct
gcaaaagaaggatacactttgacactgagactgaacttctctggccttactcgaccgaaa
gatcgcaccaaggcgatcaaccagatatcgttgctgcaatccgtcatccttagctcgcag
ctcaaggacatgctggcgagcctcggctcgtccggcacgatgaagctcgtgtacaaccaa
agggaccctttcttcgtcagcaaaacgccggtgaagataagcgccatattccccatgcgt
ttcagggacgacacggacctggccatcgcgtcgtcgttcttccaggagctacaggacctc
gggagcacgtcgtccttctccagggcgccgcggtgcagctggtcgccgatcccgccaccc
gagctgcgcggggagtacgtgcaccacctcaccaccaacggtggcttcgtgtccttcgac
atcctggcgcggcacgtgaaggggaggagggcggctaggacggcgtggatcctgctcaat
ttccagtcctacgtgaaataccatatcaagtgcacccgaagctacatccagagcaggatg
agaaagcgtctggagatcatgacagaggtgatcgatgacgcgaagttcagaggaaacgat
gagagcagcaagaagctgcaagtgaggaagagaagcaagagaagatcaatcaaattcgcg
agagccaaaaagctccaaaagggtttcaaagctgtcatcgacaagatcaagcggctgcgg
ctgaggatcagagtgaaaggcctggaccggttcaggaggcactgccagtgcttcccagtg
ctcaaactgaccatggcacagaggaaggagcagaagtaccagaagctggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344577
Entry
4344577           CDS       T01015                                 
Name
(RefSeq) actin-related protein 3
  KO
K18584  actin-related protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4344577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4344577
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4344577
   04147 Exosome [BR:osa04147]
    4344577
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4344577
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4344577
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4344577
  Exosomal proteins of other body fluids (saliva and urine)
   4344577
  Exosomal proteins of bladder cancer cells
   4344577
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 4344577
NCBI-ProteinID: XP_015650542
UniProt: B9FYW6
LinkDB
Position
8:complement(1609675..1614850)
AA seq 435 aa
MDAATRPAVVIDNGTGYSKLGFSGNSEPCFTIPTVVAVNESFLDQSEMCSSANWIAQYNA
GVMADLDFFIGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEH
YFLLTDSPVSTPESRECAGEIMFETFNVPGLYISVQSVLSLSAGYAFLKSISDEDSVSVS
DMTGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAPEDSL
DIARRVKEMYCYTSSDIVKEFKKHDKKPDKYIKHWSAIKPKTGVPYTIDIGYERFLGPEI
FFHPEIYSADFSTPLPELIDSCVQSAPIDTRRDLYKNIVLSGGSTMFKDFHKRLQNDIKK
IVDERVAATNARHHVEVKPVEVNVVAHPIQSYAAWFGGSVAASNPEFYESCHTKEEYEEH
GASICRTSTVFKGMY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggatgccgccacgcgccccgccgtcgtcatcgacaacggcacagggtatagcaaactt
ggattctctggtaactctgagccatgtttcaccatccctactgtagtagctgtgaatgag
tcttttctggaccagtcagagatgtgcagtagtgcaaattggatagcacagtacaatgca
ggtgtcatggctgacctggatttttttattggtgatgaggctctatcactatttaaatct
agtgggctgtacactagaaaacacccaattaatcatggtcaggttgatgactgggataca
atggaaagattttggcaacagtgcattttcaactatctacggtgcaatcctgaagagcac
tacttccttcttaccgatagtcctgtcagtacacctgaaagtcgtgaatgtgcaggggaa
attatgtttgagactttcaatgttcctggactatatatttctgttcaatctgtcctcagt
ctttctgctggatatgcctttctgaaaagtatttctgatgaggactcggtttctgtgtct
gatatgacaggtgtagtagttgatattggggatggagctccacatgtggtgccggttgta
aacggctacgtaattgggagtagcatcaagtcttttccattttcaggaagtgacgttaca
cagtttgttttgcagcttttacaggaaagaggtgaacttattgcacctgaggattctttg
gatatagctcgtagggtgaaagaaatgtattgctacacttcttcagacattgtcaaggag
ttcaagaagcatgacaaaaagcctgataagtatatcaaacactggtctgctattaagccc
aagactggagtcccatacacaattgatattggatatgagcgttttcttggaccagagatc
ttcttccatcccgagatttactctgccgacttctccactcctctacctgaactaattgat
agctgtgttcaatctgcgccaattgacacaaggagagatctgtataagaatatagtattg
tctggtggatctacaatgtttaaggacttccacaagagacttcagaatgacataaagaag
atagtagatgagcgtgttgccgcaactaatgcccgtcaccatgtggaggtgaaacctgtt
gaagtcaatgtggtcgcccatcctatacagagttatgcagcttggttcgggggttcagta
gctgcttctaaccctgaattttatgagagttgccacacaaaggaagaatacgaggagcat
ggagcaagcatctgccggaccagcaccgttttcaaagggatgtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345402
Entry
4345402           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2
  KO
K17260  actin-related protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4345402
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345402
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4345402
   04147 Exosome [BR:osa04147]
    4345402
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4345402
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4345402
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4345402
  Exosomal proteins of other body fluids (saliva and urine)
   4345402
  Exosomal proteins of bladder cancer cells
   4345402
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 4345402
NCBI-ProteinID: XP_015648325
UniProt: Q6Z256
LinkDB
Position
8:complement(17204579..17209484)
AA seq 389 aa
MDSGNVVVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACA
DLRHQLDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKM
IETMFEKYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGDGVTHVVPVVDGFSYPHITKRMN
VAGRHITSYLVDLLSRRGYAMNKSADFETVREIKEKLCYLSYDYKREYQLGLETTILVKS
YTLPDGRVIKVGTERFQAPEALFTPELIDVEGDGMADMAFRCIQEMDIDNRMTLYQHIVL
SGGSTMYPGLPSRLEKEMLDRYLDVVLKGNKDGLKKLRLRIEDPPRRKHMVYLGGAVLAG
IMKDSPEFWITRQEYQEEGLACLRKCGQA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggacagcgggaacgtggtggtgtgcgacaacggcaccgggtatgtaaagtgtggcttt
gcgggagagaacttccctacatctgtgttcccttgtgttgttgggcgaccattgctccgt
tatgaggagtcactccaggagcaggaattgacggatattgtggttggagcggcttgtgct
gacttgaggcatcaacttgacgtatcatatcctgttacaaatgggattgttcaaagttgg
gatgatatgggccatatatgggatcatgcattttacagtgagctgaaagttgatccttct
gagtgtaaaattctactgacagatccaccactcaatcctgtgaaaaatcgtgaaaaaatg
attgagacaatgtttgagaaatacaactttgctggggtattcatccaggtccaagctgtt
ctttcgctatatgctcaaggtttgctgactggacttgtcatagactctggtgatggtgtc
actcatgtggtgccggtagttgatggattctcttacccacatattacaaaaagaatgaat
gtagctggaaggcacataacatcttatcttgttgatctactctcaagaagagggtatgct
atgaacaaatctgccgactttgaaacagtccgggaaataaaagagaaactatgttattta
agctatgattacaagcgtgaataccagctaggacttgaaaccactatccttgtcaaaagc
tacactcttccagatggaagggtaatcaaagtgggcactgaacggtttcaagctcctgag
gctctttttactcctgaactcatagatgttgagggtgatggaatggcagatatggcgttc
cgttgcattcaagaaatggacatcgacaaccggatgacactttatcaacatattgtcctg
agtgggggaagtaccatgtatcctggtctgccaagtcgactagagaaggaaatgcttgat
cgctatcttgatgtggttctgaagggaaacaaagatggactgaagaaattgcgtttgcgg
atagaggatccgccacggagaaaacacatggtttacctgggtggtgcagtactcgctgga
atcatgaaggattcacctgaattctggattacaaggcaggaataccaggaagaaggcctt
gcgtgcctaaggaagtgtggacaagcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350726
Entry
4350726           CDS       T01015                                 
Name
(RefSeq) actin-related protein 2/3 complex subunit 5A
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4350726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4350726
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4350726
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    4350726
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     4350726
SSDB
Motif
Pfam: P16-Arc
Other DBs
NCBI-GeneID: 4350726
NCBI-ProteinID: XP_015618032
UniProt: Q2R2M0 Q0IS57
LinkDB
Position
11:20729490..20731515
AA seq 137 aa
MASSAAAYLDADENLEAIISRIEQKSRKIETLLKQSKPVEALKTALEGTPLKTRDERCKS
ANWIVVHRAMMAIRDVDGMFNSLDPEYYDILMKYLYRGLSTGDRPTCDQCLKIHEKLTEK
AGLGCILRSLADTVNTV
NT seq 414 nt   +upstreamnt  +downstreamnt
atggcttcgtcggcggcggcctacctcgacgccgacgagaacctcgaggccatcatctcc
cgcatcgagcagaagtcccgcaagatcgagaccctcctcaagcagtcgaagccggtggag
gccctcaagacggcgctcgaggggacgcccctcaagacccgcgacgagcgatgcaagtcg
gcgaactggatcgtggtgcaccgcgcgatgatggcgatcagggacgtcgacggcatgttc
aactcgctggatcccgagtactacgacatcctgatgaagtacctgtacagaggtttgtca
acaggggatcggccaacatgtgaccagtgcctcaaaattcatgaaaaactcaccgagaaa
gcaggcttaggatgtatattgcgctcacttgctgataccgtaaacaccgtgtga

DBGET integrated database retrieval system