KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324176
Entry
4324176           CDS       T01015                                 
Name
(RefSeq) cytosolic isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa04146  Peroxisome
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4324176
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4324176
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4324176
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4324176
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4324176
NCBI-ProteinID: XP_015612407
UniProt: A0A8J8XY43 Q7F280
LinkDB
Position
1:complement(26533099..26537150)
AA seq 412 aa
MAFEKIKVANPIVEMDGDEMTRIFWQSIKDKLIFPFLDLDIKYYDLGVLHRDATDDKVTV
EAAEATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNIINGTVFREPIICKNVP
RLVPGWTKPICIGRHAFGDQYRATDAVLKGPGKLKLVFEGKDEQIDLEVFNFTGAGGVAL
SMYNTDESIRAFAEASMTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKFE
AAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFALKLE
AACVGTVESGKMTKDLALLIHGSSNVTRSHYLNTEEFIDAVAAELRSRLAAN
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcgttcgagaagatcaaggtcgccaaccccatcgtcgagatggacggtgatgagatg
accaggatattctggcagtctatcaaggacaagcttatctttccatttttggatctggac
attaagtactatgacttgggagttctccaccgtgatgcaactgatgacaaggtcaccgtg
gaggctgcagaggctactctcaagtacaatgtggctattaagtgtgcgacgattactcca
gatgaggctcgggttaaggagttcaacctaaagcaaatgtggaagagccccaatggcaca
attaggaatattatcaatggcactgtattcagagagccaattatatgcaaaaatgtccca
aggcttgttccaggatggactaagcccatttgcattggaaggcatgcttttggtgatcag
taccgagcaactgatgcagttctgaaggggcctggcaagctcaagctggtttttgaggga
aaggatgagcagattgatctggaggtgttcaacttcactggtgctggaggagttgctttg
tctatgtacaacactgatgagtcaatccgagcttttgctgaagcttctatgacaactgct
tatgagaagaaatggccgctttatcttagcaccaaaaacacaatcctgaagaaatatgat
ggaaggttcaaggatattttccaggaggtctatgaagctgggtggaaatccaagtttgag
gctgccggaatatggtatgagcatcgtctcatcgatgacatggttgcttatgcacttaag
agtgaagggggctatgtgtgggcttgcaagaattacgatggagatgtgcagagtgatttc
ttagctcaaggctttggttcattgggtttgatgacatcagtattggtgtgccctgatgga
aaaacaattgaagctgaagctgcccatggcacggttacccgtcatttccgtgttcaccag
aagggaggtgaaaccagcacaaacagcattgcttcaatctttgcttggaccagaggactt
gcacacagggcaaagcttgacgacaatgctagacttcttgactttgcactaaaacttgaa
gctgcttgcgttggaaccgtggaatctgggaagatgaccaaagaccttgctcttcttatt
cacgggtcttcaaacgtcacaagaagccattacctgaacactgaagagttcattgatgcg
gttgctgcggagctccggtcaagactggcagccaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327213
Entry
4327213           CDS       T01015                                 
Name
(RefSeq) cytosolic isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa04146  Peroxisome
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4327213
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4327213
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4327213
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4327213
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4327213
NCBI-ProteinID: XP_015614157
UniProt: Q9XHX4 Q5NAL8
LinkDB
Position
1:8170314..8175905
AA seq 414 aa
MAFEKIVVANPVVEMDGDEMTRVIWKWIKDKLIFPFLDLDIKYYDLGLPNRDATGDKVTI
ESAEATLKYNVAIKCATITPDEGRVKEFNLSAMWKSPNGTIRNILNGTVFREPIICKNIP
RLVPGWIKPICIGRHAFGDQYRATDTVIKGPGKLKLVFDGREEQIELDVFNFTGAGGVAL
SMYNTDESIWAFAEASMNMAYQKRWPLYLSTKNTILKKYDGRFKDIFQENYETKWRAKFD
DAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDLIAQGFGSLGLMTSVLVCPDG
RTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTTGLGHRAKLDDNKRLLDFVQKLE
AACVGTVESGKMTKDLALLVHGPNVSRDKYLNTVEFIDAVAEDLRTRLSVTSKL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcgttcgagaagatcgtcgtggccaaccccgtcgtcgagatggacggtgatgagatg
actcgagttatttggaaatggatcaaagataagcttatattccctttcttggacttggac
ataaaatactatgacttaggtctacctaatcgtgacgctactggggacaaagttacaata
gagagtgcagaagcgaccctaaagtataatgtagccatcaaatgtgcaactataactcca
gatgaaggacgcgtgaaagagtttaatttaagtgcaatgtggaagagtccaaatgggaca
ataaggaacattttgaatggaactgttttccgagaaccaatcatctgcaagaatattcct
cggcttgtacctgggtggataaagcccatatgcattggacgacatgcatttggtgatcaa
taccgagcaacagatacagttattaaaggtcctgggaagttgaagttagtatttgatggc
agagaggaacaaatagagttggatgtgttcaactttactggtgctggtggagtagccttg
tctatgtataatactgacgagtctatttgggcattcgctgaagcttccatgaacatggct
taccagaaaagatggccactttatcttagcaccaaaaacacgatcctcaaaaaatacgat
ggaaggtttaaagatatatttcaggagaactatgaaacaaaatggagagccaagtttgat
gatgcaggaatatggtacgaacatcggctgattgatgatatggtggcctatgcccttaag
agtgaaggtggctatgtttgggcttgcaagaactatgatggagatgtgcagagcgatcta
attgctcaaggttttggatcgctaggtctaatgacatcagttctggtgtgccctgatggt
agaaccattgaagctgaagctgctcatggtacagtcacacgccattacagagttcaccaa
aaaggaggcgaaactagtacaaatagcattgcttcaatatttgcttggacaaccggacta
ggacatagggcaaagctcgatgacaataaaagactgttagattttgtacaaaaacttgaa
gctgcttgtgtgggaacagtggaatctggaaagatgacaaaggatctagctcttcttgta
catgggccaaatgttagccgagataagtatcttaacactgttgagttcatcgatgctgtt
gctgaggatttaagaacaagattgtcagtaacatccaagttatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336353
Entry
4336353           CDS       T01015                                 
Name
(RefSeq) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa04146  Peroxisome
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4336353
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4336353
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4336353
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4336353
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4336353
NCBI-ProteinID: XP_015633401
UniProt: Q0JBV4 A0A0P0WCM6
LinkDB
Position
4:25389655..25395413
AA seq 478 aa
MRHLLLLRCGMAPLYGSSSSAAATKALLLNPAAAHAFVPSSPGPRALRRGGASLRCYAAA
AAAVAEQHRIKVHNPIVEMDGDEMTRVIWKMIKDKLIFPYLELDVKYFDLGLLNRDATDD
KVTVESAEATLEYNVAVKCATITPDETRVKEFKLKSMWRSPNGTIRNILNGTVFREPILC
KNVPRILSGWKKPICIGRHAFGDQYRATDTIINGPGKLKMVFVPDGAEPVELNVYNFKGP
GVALSMYNVDESIRAFAESSMAMALSKKWPLYLSTKNTILKKYDGRFKDIFQEVYEEKWK
EKFEENSIWYEHRLIDDMVAYAVKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMSSVLL
SSDGKTLEAEAAHGTVTRHFRLHQKGQETSTNSIASIFAWTRGLEHRAKLDKNDRLLDFT
KKLESACIETVESGKMTKDLALLIHGPKVTREFYLNTEEFIDAVAQQLREKIQIPAVV
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcgccacctgctgctcctgcgctgcggcatggctcctctctacggctcctcctcctcc
gccgccgcgaccaaagccctcctcttaaaccccgccgccgcgcacgccttcgtcccttct
tcccccggaccccgcgcgctccgccgcggcggcgcctccctccgctgctatgccgccgcc
gccgcggcggtggccgagcagcaccgcatcaaggtccacaaccccatcgtcgagatggac
ggtgacgagatgacgcgggtcatttggaagatgataaaggataagctcatcttcccttac
ctggagctggatgtcaagtatttcgaccttgggctgctcaaccgggatgccaccgatgat
aaggtcactgttgagagtgccgaggctacgttggagtataatgttgctgttaagtgtgct
accattacacctgatgaaacaagagttaaagagttcaaactcaagtcaatgtggaggagc
ccaaatggcaccatcaggaatattctaaatggaactgttttccgggagcccatcttgtgt
aaaaatgtaccacggatactttctggctggaagaagcccatttgcattggaaggcatgca
tttggagaccagtatcgagctactgatacaataattaatggtccaggaaagcttaaaatg
gtttttgtcccagatggtgctgaacctgtggagttaaatgtttataattttaaagggcct
ggtgtggctttatcaatgtataatgtggatgagtctattagagcttttgctgagtcatca
atggcaatggcactttccaaaaaatggcctctttatctcagcaccaagaacacaatattg
aagaaatatgatggcaggttcaaggacatcttccaggaggtatatgaagagaaatggaag
gagaagttcgaggaaaactcgatatggtatgagcaccggttgattgatgacatggtggca
tatgctgtgaaaagtgaaggtggatatgtttgggcttgcaaaaactatgatggagatgtt
cagagtgacttccttgcccaaggttttggttccttgggtttgatgtcatctgttttgtta
tcttctgatgggaaaacgttagaagctgaggcagctcatgggactgtcactagacatttc
aggctacatcagaagggacaggagacaagtacaaatagcattgcttctatatttgcttgg
actcgtggactagaacatagagcaaagctggataaaaatgataggctgctggatttcaca
aagaaacttgaatctgcatgtattgaaacagttgaatcggggaagatgacaaaggatctt
gcactccttatccatggccccaaggtaacaagggagttctaccttaacaccgaagaattc
attgacgctgtggctcagcaactgcgagaaaagattcaaataccagctgtggtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339674
Entry
4339674           CDS       T01015                                 
Name
(RefSeq) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
osa04146  Peroxisome
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4339674
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4339674
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4339674
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4339674
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4339674
NCBI-ProteinID: XP_015640220
UniProt: A0A0P0WR73
LinkDB
Position
5:28547533..28551361
AA seq 412 aa
MASTKIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPYRDQTDDKVTV
EAAEATLKYNVAIKCATITPDEARVKEFSLKSMWKSPNGTIRNILNGTVFREPIICKNIP
RLVPGWTKPICIGRHAFGDQYRATDAVIKGPGKLKLVYEGKDEEIELEVFNFTGAGGVAQ
SMYNTDESIRSFAEASMATAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAQWKSKFE
AAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFTQKLE
AACIGAVESGKMTKDLALLVHGSSNVTRSHYLNTEEFIDAVADELRSRLAAN
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcatccaccaagatcaaggtcgccaaccccattgtcgagatggacggtgatgagatg
actcgagtattctggaaatctatcaaggacaagcttatcttcccgttcttggagttggac
attaagtactttgatctcggacttccataccgtgatcaaaccgacgataaagtcacagtg
gaggcagcagaggctaccctcaagtacaatgtggccatcaagtgtgcaaccattacacca
gatgaagcaagggttaaagagttcagcctaaaatccatgtggaagagcccaaacggcaca
attagaaatatcctaaatggcactgtgttcagagaaccaataatctgcaaaaacatccct
cggcttgttccaggatggactaagcccatttgcattggaaggcacgcatttggtgatcag
taccgtgcaacggatgcagttatcaagggacctggcaagcttaaattggtttatgaggga
aaagatgaggagattgagctggaggtgttcaacttcactggtgctggaggagtggcacag
tctatgtacaacactgacgagtccatccgttcctttgctgaggcctctatggccactgct
tatgagaagaaatggccattgtacctcagcaccaaaaacacaattttgaagaaatatgat
ggcaggttcaaggacatcttccaggaggtatatgaagctcagtggaaatcaaaatttgag
gctgctggaatatggtatgagcatcgtctcattgatgacatggttgcctatgcactcaag
agtgaaggaggctatgtttgggcttgcaagaactatgatggagatgtgcagagtgatttc
ttagcacaaggttttggatcattgggtttgatgacatcagttttggtatgtcctgatggg
aaaaccattgaagctgaagctgcccatgggactgtcacccgtcattaccgtgttcatcag
aaaggtggtgaaactagcacaaacagcattgcctcaatctttgcctggacaagaggactt
gcacacagggcaaagctagatgacaatgctaggctactggacttcactcagaagcttgaa
gctgcctgcattggcgctgtcgagtctgggaagatgaccaaggaccttgctctgcttgtt
cacggatcttcaaatgtcacgaggagtcattacctgaacactgaagagttcatcgatgct
gttgctgacgagctcagatcaaggctggcagccaactaa

DBGET integrated database retrieval system