KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324180
Entry
4324180           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 4 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4324180
   00071 Fatty acid degradation
    4324180
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4324180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324180
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324180
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4324180
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4324180
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4324180
  Exosomal proteins of breast cancer cells
   4324180
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4324180
NCBI-ProteinID: XP_015621379
LinkDB
Position
1:26628856..26636957
AA seq 685 aa
MEMQHVVEVEQGRAAADGRPSVGPAYRSAFARGGFPPPVAGLDCCYDIFRMAVEKFPDNR
MLGHREIVDGKAGAYVWKTYKEVFDLSTKIGNSIRSRGLAKGSRCGIYGANCPEWIITME
ACNAHGIYCVPLYDTLGAGAVEFILCHAEVEIAFTEEKKIEQIFKTFPKSAEFLKTIVSF
GKVTQEQKENASKYGLEIYSWDEFLSLADQEFDLPVKAKTDICTIMYTSGTTGDPKGVLI
SNASIICLVAGVDRLLNCVNEQVRYASSPFIMHPYIITDQSLIALTMRESQLEQTDVYMS
YLPLAHIFDRVVEELFMFHGASIGFWRGDVKLLVEDIGTLKPTILCAVPRVLDRIFSGLQ
AKIASGGFIKSTLFNLAYKFKQFRMMKGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSG
AAPLATHVEEYLRVVTCAHVLQGYGLTETCAGSFVSLPNQMCMIGTVGPPVPNIDVCLES
VPEMNYDALATRPRGEICIRGETVFSGYYKREDLTKDVLIDGWFHTGDIGEWQPDGSMKI
IDRKKNIFKLSQGEYVAVENLENIYGLVSAIDSIWVYGNSFESFLVAVVNPNKEALESWA
AANGISGDLEALCENPKAKEYILGELSKVGKEKKLKGFEFIKAVHLEPVPFDMDRDLITP
TYKKKRPQLLKYYQGTIDNMYRSAK
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggagatgcagcacgtggtggaggtcgagcagggccgcgcggccgccgacggccggccc
tccgtgggccccgcctaccggagcgccttcgcccgcggcggcttcccgccgcccgtcgcc
ggcctggactgctgctacgacatcttccgaatggccgtggagaagttcccagacaacaga
atgcttggtcaccgtgagattgttgacgggaaggctggtgcatacgtttggaagacatac
aaggaggtgtttgacctttcgactaagattggtaactctattaggagccgtggacttgca
aagggaagccgttgtggtatctatggtgctaattgtcctgaatggattatcacgatggag
gcctgcaatgctcatggaatctactgcgttccattatatgacactcttggagctggtgct
gtagagtttattttgtgccatgcagaagttgagattgctttcacagaggagaaaaaaatt
gagcagatcttcaagactttccccaagtcagctgaattcttgaaaacaatcgttagtttt
gggaaggtaactcaggaacaaaaggaaaatgcctccaaatatgggctggagatctattca
tgggatgaatttctttctttggcagaccaagaattcgatcttccagtgaaagcaaagact
gacatatgtactataatgtataccagtggaactactggtgaccccaaaggtgtactgatc
tccaatgcaagcattatttgcctagtcgcaggtgtagatcggctgcttaactgtgtaaat
gagcaggtaagatatgccagcagccctttcattatgcatccatatataatcactgatcaa
tctttaattgctttaactatgcgggaatctcagctggagcaaaccgatgtttacatgtct
tatcttccacttgctcatatctttgatcgtgttgtggaagagctatttatgttccatggt
gcttccattggattttggcgtggggatgttaagctgcttgttgaagatattgggacactg
aaaccaactatcttgtgtgctgttccacgtgtgcttgaccggatattttctggactccaa
gctaaaattgcatctgggggtttcataaagagtacattgttcaatcttgcttacaaattc
aagcaatttagaatgatgaaaggagctaagcacaatgaagctgccgcaatatgtgacaaa
gtagttttcagtaaggtgaaagaaggtcttgggggaaatgttcgtgttattttgtccgga
gctgctccacttgctactcatgttgaagaatacctgagagtggtgacttgtgcacatgtc
ttacaaggatatggtctcacggagacttgtgctggatctttcgtctccctaccaaatcag
atgtgcatgatagggactgttggtcctccagtgccaaatattgatgtctgcctggaatca
gtgcctgaaatgaattatgatgcacttgcaactagaccgcgtggcgaaatctgcatcagg
ggagaaacagtattctcaggatactacaagcgtgaagaccttacaaaggatgttttgatt
gatggatggttccatactggagacattggtgagtggcaacctgatggaagtatgaaaatc
atagatcgcaaaaagaatatcttcaagctttcacaaggagaatatgtagcagtagaaaat
ttggagaacatttatggtcttgtttctgctatagattcgatatgggtatatgggaatagc
tttgagtcattccttgttgctgtggtcaatccaaacaaggaagcattggagagctgggct
gcagcaaatggaatcagtggtgatttggaggcattgtgtgagaaccccaaagcaaaagaa
tacattttgggagaactgtcaaaagtaggaaaagagaagaagctcaaaggttttgaattc
ataaaggctgtacatcttgaaccagtgccatttgacatggaccgtgatttgattactcca
acatataaaaagaagcgccctcaattgctcaagtactaccagggaacaattgacaacatg
tacagaagtgccaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324393
Entry
4324393           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 4 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4324393
   00071 Fatty acid degradation
    4324393
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4324393
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324393
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324393
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4324393
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4324393
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4324393
  Exosomal proteins of breast cancer cells
   4324393
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4324393
NCBI-ProteinID: XP_015621736
UniProt: A0A0P0V6M8
LinkDB
Position
1:complement(28060005..28067171)
AA seq 665 aa
MAASTMKHLVQVGEAREAAEEDGGAPSAGPAYRCAYGGGAASPPAVPGLECCWDIFRMTV
ERCPDNKMLGRREIVDGKAGKYTWITYKEAYDTVIKVGASIRSLGVGKGGRCGIYGANCP
EWVISMQACNAHGIYCVPLYDTLGAGAVEFILCHAEVEIAFIEEKKIGEVLKTFPNATKY
LKTIVSFGKVNPEQKEKVEQNGVSIYSWEEFLQLGGEEKYELPTKQKDDICTIMYTSGTT
GDPKGVLISNRSIITIISAVDGFLANSKEQLREDDVYISYLPLAHIFDRVLEEVFIHHGA
SIGFWRGDVKLLVEDIGELKPTIFCAVPRVLDRIYGGLQDKVSTGGFLKKTLFNVAYKYK
QGNMVKGSKHEEAAAMFDKLVFTKVKRGLGGRVRLILSGAAPLSNHVEEYLRVVTCSLVL
QGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVHLESVPEMGYDALSKESPRGEICIR
GDTLFSGYHKREDLTKEVLVDGWFHTGDIGEWQSDGSMKIIDRKKNIFKLSQGEYVAVEN
LENIFGQAPGVDSIWVYGNSFESCLVAVVNPNKQALERWAESNGVTGDFATMCEDPKAKE
FILGELTKTGKEKKLKGFELIRAVHLEPVPFDMDRDLITPTYKKKRPQLLKYYQNVIDSM
YKNMK
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcggcctcgacgatgaagcacctcgtgcaggtcggggaggcgcgggaggcggcggag
gaggacggaggggcgccctcggccgggccggcgtaccgctgcgcctacggcgggggcgcc
gcctcgccgcccgccgtgccggggctcgagtgctgctgggacatattccggatgacggtg
gagaggtgcccggacaacaagatgttgggccgccgagaaatcgtcgacggcaaggctggc
aagtacacgtggataacttacaaggaagcgtacgacaccgtgatcaaggtgggcgcgtcc
atccggagccttggagtcggcaagggtggacgctgtggtatttacggagccaactgccct
gagtgggttatcagtatgcaggcctgcaatgcccatggcatatactgtgttccgttgtat
gacacgctaggtgctggggctgtagaatttatactgtgccatgctgaggtagaaattgct
tttatagaggaaaagaagataggagaggtgctcaagacatttccaaatgcaacaaagtat
ttgaagacaattgtgagctttggaaaggtcaatcctgaacaaaaggaaaaggttgaacaa
aacggagtgtccatctactcgtgggaagagtttttgcagttgggaggtgaagaaaagtat
gaacttcctacaaagcaaaaggatgatatctgtacaataatgtacaccagtggaacaact
ggtgaccctaagggagttttaatctccaacaggagcattattactattatttcagcagta
gatgggttccttgcaaactcaaaagagcagcttcgtgaagatgatgtttacatttcttat
cttcctcttgcccatatctttgaccgtgtacttgaggaagtgttcattcaccatggtgca
tcaattggattttggcgtggagatgtcaaactcttggttgaagacattggagaactcaag
ccaacaattttctgcgctgttccacgtgtactagacagaatttatggaggactgcaagat
aaagtttcgactggtggtttcctgaagaagacactgtttaatgttgcttacaaatacaaa
caagggaatatggtgaaaggaagcaagcatgaagaagctgctgccatgttcgataaacta
gtcttcaccaaggttaaacgaggattaggtggcagagtacgacttattttgtctggtgca
gctcccctgtctaatcatgttgaagagtacctgcgtgtggtaacttgctcccttgttctt
cagggctatggtcttactgagacctgtgctgggtccttcgtttcccttccaaacaacatg
tcgatgctgggaactgtaggccctccagtcccctatgtcgaagtacacctcgagtctgtt
cctgaaatgggatatgatgcattgtcaaaagaatcacctcgtggggagatttgcatcaga
ggggacaccttgttctcagggtaccacaaacgagaagacctcaccaaggaagttttagtc
gatggatggtttcacacaggagacattggtgagtggcagtctgatggaagcatgaagatc
attgatcgcaagaagaacatcttcaagctctcccaaggagaatatgtcgctgtggagaat
ttggagaacatattcggtcaagctcctggtgttgattcgatttgggtgtacgggaatagc
ttcgaatcatgcttggttgcagtggtcaacccgaacaagcaagctctggaacgatgggca
gagtcaaacggggtaactggagactttgctaccatgtgtgaagatcctaaagcaaaagaa
tttatcttgggagaattaaccaagactggtaaagaaaagaagctcaaaggctttgagctc
atcagggctgttcatctggagccagtgccattcgatatggatcgtgacctaattacccca
acttacaagaagaagcggccacagctgctcaaatattaccagaacgtcatcgacagcatg
tataagaacatgaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334764
Entry
4334764           CDS       T01015                                 
Name
(RefSeq) probable acyl-activating enzyme 16, chloroplastic
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4334764
   00071 Fatty acid degradation
    4334764
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4334764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4334764
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334764
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4334764
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4334764
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4334764
  Exosomal proteins of breast cancer cells
   4334764
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF5010
Other DBs
NCBI-GeneID: 4334764
NCBI-ProteinID: XP_015627817
UniProt: B9F7K3 Q75LB3
LinkDB
Position
3:complement(35549178..35558050)
AA seq 750 aa
MLASSASGQMAALCSPSPTLPTASLLLLRRRRLRLLHPPPSAAALLLLLPARRRGRHHHR
RGGVLRCDAAAASPSAGSTLENPVRRKCSPLLESALLPGGNGLTTHDWMAVPDIWRTAAE
KYADRVALVDPYHEPPSELTYKQLEQEILDFSQGLRAIGVAPDEKIALFADNSCRWLVAD
QGIMATGAINVVRGTRSSDEELFQIYTHSESIALVVDSPQFFNRLAESFISRINARFIVL
LWGEKSCLNSEVVNGIPLYDFKDITQLGRESRNTLRHSHEQGQQVVFETITPDDVATLIY
TSGTSGTPKGVMLTHRNLLHQIKNLWDFVPAVPGDRFLSMLPPWHAYERASEYFIFTYGI
QQVYTTVKYLKEDLQRYQPQYIVSVPLVYEILYSSIQRQISSSSTARKFVALALIKISLL
YMEAKRIYEGTVLSNNPVKPSFIVYMVNWLSARIVAALLWPLHNLAKTLVYKKIHSAIGI
SKAGISGGGSLPMHVDKFFEAIGVKVQNGYGLTETSPVVAARRPFCNVLGTVGHPVKHTE
IKVVDMETGEVLPDGSKGVVKVRGPQVMKGYYKNPSATNKVLDQEGWFDTGDIGWIAPHC
PTGPSRKCGGMLVLEGRAKDTIVLTTGENVEPAEIEEAASRSDLINQIVVVGQDKRRIGA
LIVPNYDEVLATAKRKSILDGNNELAKDKVLNLLYDELRTWMVDCSFQIGPILIVDEPFT
VDNGLLTPTLKLRRDKVTAKYHREIDALYK
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgctcgcctcctccgcctccggccaaatggcggcgctctgctccccctcgccgacgctc
cccaccgcctccctcctcctcctgcgtcgccgccgcctccgcctcctccacccaccgcct
tccgccgccgcgctgctgctcctcctccccgcccgccgccggggccgccaccaccaccgc
cgaggtggggtcctccggtgcgacgccgccgcggcgtccccctccgcgggttccacgcta
gaaaacccagttcgcagaaagtgctcaccattacttgagagtgctctattacctggtgga
aatggtttgactacgcatgattggatggctgttccagacatttggaggacagcagcagaa
aaatatgctgaccgtgtagctttggtagatccttaccatgaacctccttcagaattgact
tataagcagcttgaacaagaaatattggatttttctcaaggtctaagggccattggagtt
gctccagatgaaaagatagccctttttgctgataactcatgccgatggctagttgcagat
caaggaatcatggctactggtgctataaatgttgttagaggaacaagatcttctgatgaa
gaattatttcaaatttacactcattcagaaagcattgcacttgttgtggacagtcctcaa
ttctttaaccggcttgcagaatcttttatttcgaggattaacgcaagatttattgtgcta
ctttggggtgagaaatcgtgcctaaacagtgaagttgtgaatggaataccactttatgac
ttcaaggatatcactcaactcggacgagaaagccgtaatacattgcgtcactctcatgaa
caaggtcagcaggtcgtctttgaaactattactccagatgatgttgctacactaatatat
accagtggaacgagtggaacaccaaaaggagtgatgcttacccaccgaaacctcttgcat
cagattaaaaatttgtgggattttgtaccagcagtacctggtgataggttcctaagcatg
cttccaccatggcatgcatatgagcgtgctagcgagtacttcatcttcacttatggaatt
caacaagtttacacgactgtcaagtacctgaaggaagatttgcaacgataccaacctcaa
tacatagtatcagttccactggtctatgagattctctacagctcaattcagagacagata
tcttccagttcaactgctcggaaatttgttgctcttgcacttattaagataagtttgcta
tatatggaggcaaagaggatatacgagggaacagtcctatcgaacaatcccgtcaaacca
tcctttattgtgtatatggtcaattggctatctgcaagaattgttgctgcacttctgtgg
cctttgcataatctggcaaagacgttagtctacaagaaaatccattctgcaattgggatt
tcaaaggctggcattagtggtggtggaagtctcccgatgcatgttgacaaattttttgag
gccatcggtgtcaaagtgcaaaatggctatggtctaacagagacatcccctgttgtagct
gctagacggccattctgtaacgttcttggcacagttggccacccagtaaagcacacggaa
atcaaggttgtggatatggagactggtgaggttcttccagatggttcaaagggggttgtg
aaagtcagaggaccccaagtgatgaagggatattacaagaatccgtcagctacaaataaa
gttttggatcaagaaggttggtttgacacaggggatattggttggattgcacctcactgt
ccaacagggccaagtcggaagtgtggagggatgcttgttcttgaagggcgtgcaaaagat
acaatagttctcacaacaggtgaaaatgttgaacctgctgagattgaggaagcagccagc
aggagtgacttgattaatcagatagttgttgttggccaggacaagcggcgaattggtgct
cttatcgttcccaactatgatgaagttctagcaacagctaaaaggaagtccattcttgat
gggaataacgaactagccaaagataaggttttgaacttgctatatgatgagctgagaact
tggatggtggattgttccttccaaattggcccgattctaattgtcgatgaaccatttacg
gtggataatggtttgctaacacccactttgaaattacggagggacaaagtgactgccaaa
tatcatagagagattgatgcgttgtacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337714
Entry
4337714           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4337714
   00071 Fatty acid degradation
    4337714
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4337714
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4337714
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337714
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4337714
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4337714
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4337714
  Exosomal proteins of breast cancer cells
   4337714
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4337714
NCBI-ProteinID: XP_015639871
UniProt: A0A0N7KK36
LinkDB
Position
5:complement(1866991..1873439)
AA seq 669 aa
MEGGTKKVFTVQVEDGKPRKDGRPAVGPVFRSALSKDGFPPLEPDMKTSWDVFRVAAGKY
PDNRMLGWRPVKDGVIGPYIWKSYREVYEEVLQVGSALQQLGVKPGSRIGIYGSNCPQWI
VAMQACNGYSLICVPLYDTLGAGAVDFIIDHAEIDVIFVQDKKIKEILSANCKSAKRVKG
LVAFTSGTSEEITSADQIGMKLYSWKDFLKMGKENPAQPCAPKPNDTCTIMYTSGTSGEP
KGVMLSHESHAIYVKGVDLFMEQFDDKMTTDDVFLSFLPLAHILDRMIEEFFFHKGASVG
YYHGDLNALRDDLMELKPTLLVGVPRVYEKIYEGILKALSELRPLRRLIFNALYNRKLAN
MKAGCTHKTASPFADMLAFRKVKARLGGRLRLLISGGAPLSNEIEEFLRVTSCAYFIQGY
GLTETLGPSTVCYPDDMSLVGTVGVAATYTELRLEEVPEMGYNPLGTPSRGEICVRGNFF
TGYYKNPELTNEVMADGWFHTGDIGEMNSDGILKVIDRKKNIFKLSQGEYVAVEYLEKVY
VFPPTVEDVWVYGDSFRSMLVAVVNPHEENTMKWAESNGCKGSFAEICKSEGLKEHILKE
LQSVAAKNKLRGFEYVKGVILDPIPFDLERDLVTATMKKKRNNMLKYYKPEIEKVYQKLE
EQRVAAKSK
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggagggggggacgaagaaagttttcacagttcaggtggaggatggaaagcccaggaag
gacggccggccggcggtagggccagtgttcaggagtgcactgtcaaaggatggattcccg
ccacttgagcctgacatgaaaacatcatgggacgtgttcagggtcgcagcaggcaagtac
ccagataatcggatgctcggatggcgtcctgtaaaagatggagtgatagggccatacata
tggaaatcatacagggaagtgtatgaagaagtcctgcaagttggatctgctttgcagcag
ctgggggtgaagccaggttcccggattggaatatatggatcaaactgccctcagtggata
gtagcaatgcaggcttgcaatggttacagcttaatctgtgtcccactctacgatacgtta
ggtgcaggagctgttgacttcattattgaccatgctgaaatcgatgttatctttgttcag
gacaagaaaataaaagaaatactgtccgcaaattgcaagtctgctaagagagtgaaagga
ctggtggcatttacttcgggaacaagcgaagaaatcacaagtgctgatcagattgggatg
aagttgtactcgtggaaagatttcttaaaaatgggaaaggaaaatccagcccaaccttgt
gctccaaaaccaaatgatacatgcaccatcatgtacacaagtgggacaagtggagagccc
aaaggtgtcatgcttagccatgagagtcatgccatatatgtgaaaggtgtggacctcttc
atggagcagtttgacgataagatgacaacagatgatgtgtttctttcctttctaccgctt
gctcacatccttgaccgcatgatcgaggagtttttctttcacaaaggagcctcagttggc
tattatcatggggatttgaatgccttgagagatgatctcatggagctaaagccaactcta
ctagttggggtgcctcgagtgtatgaaaaaatttatgaaggtatcttgaaggccttatca
gaactcagaccactcagaagattaattttcaatgctctgtataaccgcaaactggcaaac
atgaaagcaggctgcacgcacaaaactgcttcaccttttgcagatatgttggctttccgc
aaggtcaaagcaaggcttggtggtcgtcttcgcctattaatctcgggtggggctccatta
agtaatgagatcgaagagttcttgagagtaaccagctgcgcatactttatccaaggctat
ggtttaacagaaacactgggacctagcacggtctgttaccctgatgacatgtccctggtt
ggaactgttggcgtggctgctacctatacggaattgcgattggaagaagtgcctgagatg
ggttacaatccacttggtactccttcccgtggtgaaatatgcgtccgaggaaacttcttc
accggatactataaaaatcctgagctcacgaatgaggtcatggctgatggatggtttcac
acaggtgacattggagagatgaactcagatggaatcctgaaggtaattgaccgaaagaaa
aatatattcaagttgtcacaaggggagtatgttgcagttgaatacctggagaaagtatat
gttttccctccaaccgttgaagatgtctgggtatatggggacagcttcagatcaatgtta
gtggcagtagttaatccacatgaagagaacaccatgaagtgggcagaatcaaatggctgc
aagggttcttttgctgaaatatgcaagtctgaaggccttaaagagcatatcctgaaagag
ctgcaatctgttgcagcaaagaacaagctacggggatttgagtatgtcaaaggtgtaata
ttggaccctattccttttgaccttgaaagggatttggtgactgcaacaatgaaaaagaaa
agaaacaacatgctaaaatattacaagcctgagattgagaaagtataccaaaaactggag
gaacagagggttgccgccaaatcaaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338395
Entry
4338395           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 8
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4338395
   00071 Fatty acid degradation
    4338395
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4338395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4338395
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338395
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4338395
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4338395
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4338395
  Exosomal proteins of breast cancer cells
   4338395
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4338395
NCBI-ProteinID: XP_015639433
UniProt: A0A0P0WKP4 Q5W6W7
LinkDB
Position
5:14688244..14701276
AA seq 726 aa
MGENTGDNPNMSILQRIATSDVPLVKEYGLPGIIGAILLAVVIPIMLSSIFNKKGKKRAV
QADVGGEAGLAMRNSRFSMLVEVPWEGATTMAALFEMASKKYPRHRCLGTRKLINREFVE
SPDGRKFEKLHLGEYEWDTYAEAFSRACNFSSGLIKLGHQRDSRAAIFADTRTEWIIAAQ
GCFRQNLTVVTIYASLGEDALVHSLNETQVSTLICDSKQLKKLPAISSKLQSVKHVIYIE
DEPVEAEVLNQMKHWTTFSFGEVEELGKTSHTDARLPSSTDTAVIMYTSGSTGLPKGVMI
THGNMVATTAAVMTIIPKLGTGDVYLAYLPLAHVFELAAETVMLASGAAIGYGSALTMTD
TSNKIKKGTKGDVSALKPTLMISVPAILDRIRDAVFKKVGEKGGLTKKLFDIAYKRNLGA
IEGSWFGSWAPERMIWDNLIFKPIRSMLGGRIRFVLCGGAPLSSDTQRFMNICLGVPVGQ
GYGLTETCAGAAFSEWDDTSVGRVGPPLPCCYVKLVSWEEGGYKISDSPMPRGEVVVGGY
SITKGYFNNEAKTNEVYKVDERGMRWFYTGDIGQFHPDGCLEIIDRKKDIVKLQHGEYVS
LGKVESALTTSNYVDSIMVYADPFHNYCVALVVPAHQALEQWAQNSGINYKNFDELCHND
QAIKEVQQSLSKAAKAARLEKFEIPAKIVLLPEPWTPESGLVTAALKLKREQIKTKFKDD
LGKLYH
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgggagaaaatactggcgataatccaaacatgtcaattcttcaaagaattgccacaagt
gatgttccactggtgaaagagtatggtctgcctggaattattggtgccattctacttgct
gtagttattcctatcatgctttcttccatattcaacaaaaagggaaagaaaagagcagta
caagctgatgtgggtggtgaggcaggacttgccatgcgaaacagtagattttccatgtta
gttgaagttccatgggagggtgccaccacaatggcagctttatttgagatggctagcaaa
aaataccctcgacacaggtgtcttggcacaaggaagctaatcaatagagaatttgtggag
tcacctgatggcaggaagttcgagaaattgcatttaggtgaatatgaatgggatacctac
gcagaagcatttagtcgtgcatgtaatttttcttctggtctcatcaagttgggtcaccaa
cgagatagtcgtgctgcaatatttgctgatacaagaactgagtggatcattgctgctcag
ggatgctttcgacaaaatctaacagttgtaactatctatgcatctcttggcgaggatgca
ctggtgcattcactgaatgagacacaggtttcaactctgatatgtgattcaaagcaactt
aagaagctacctgcaatcagttccaagttgcagagtgttaagcatgttatctatattgag
gatgaacctgttgaggctgaggtactcaatcaaatgaagcactggacaacattttctttt
ggtgaagttgaagaattgggtaaaacatcacatacagatgcaagattaccttcaagcact
gatactgcagttattatgtatacaagtggaagtacgggtcttcccaagggtgtaatgatt
acacatggaaatatggtggccacaactgcagctgtcatgacaatcataccaaaacttggc
acaggggatgtttatctggcataccttccgctggctcatgtctttgaactagcagcagag
actgtcatgttagcttctggtgctgccattggatatggctcagctctgactatgacagat
acatcaaataaaataaagaaggggacaaaaggagatgtttctgcactgaagcctactctt
atgatttcagtccctgcaattttagaccgcatcagagatgccgtgtttaaaaaggttggt
gagaagggtggtctgaccaaaaagctgtttgacattgcctataaacgaaatcttggagct
attgaaggaagttggtttggatcctgggcaccagagaggatgatatgggataacctcatt
tttaaaccaatacgttccatgcttggtgggcgcattagatttgttctttgtggtggtgca
cctctatcgagtgacacacaaagatttatgaatatatgtcttggtgtaccagtaggtcaa
ggctatggattgacagagacttgtgctggagcagccttttctgaatgggatgacacaagt
gtgggccgtgttggtccaccccttccttgttgctatgtcaagctcgtttcatgggaagaa
ggtggctataaaatttctgattctccaatgccccgaggagaggttgtagttggtggatac
agcataacaaaaggttatttcaacaatgaagcaaaaacaaatgaggtctacaaggtagat
gagaggggaatgcgctggttttacactggagatattggccagttccatcctgatgggtgc
ctcgagatcattgatagaaaaaaggatatagtaaaacttcagcatggagaatatgtgtct
cttggcaaggttgaatcagctctaactactagcaattatgtggacagcataatggtttat
gctgatccatttcataattattgtgtggcgttggtagtgccggcgcaccaggccttagag
cagtgggctcaaaattctgggattaactacaaaaactttgatgagctgtgccacaatgat
caagccattaaggaggtccagcaatctctatcaaaggctgcaaaagcagcgaggcttgag
aagtttgaaataccagcaaagattgtgttgctgcctgaaccatggactccagagtctggg
ctggtgacagctgcacttaaactgaagagggagcagataaagaccaaattcaaagatgat
ctgggcaagctctatcactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340187
Entry
4340187           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4340187
   00071 Fatty acid degradation
    4340187
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4340187
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4340187
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340187
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4340187
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4340187
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4340187
  Exosomal proteins of breast cancer cells
   4340187
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 4340187
NCBI-ProteinID: XP_015643056
UniProt: B9FRL4
LinkDB
Position
6:2949769..2957893
AA seq 652 aa
MMKHLVESEKAAENAGPTYRNVLAKDAGLLRPPPGVESCWDVFRNSVEKYPDSPMLGRRR
VVDDGKAGEYVWMTYKEVYDVVMKLAASISKSGISKGESCGIYGANCPEWIISMEACNAL
GVSCVPLYDSLGAGAVEFIVCHAEIQIAFVEERKIAELLKTCHATSKYLKTIISFGGVTN
DQKEEAKNHGMSIFSWEEFLIMGGDHHFDLPEKKKSDICTIMYTSGTTGDPKGVMISNES
LLVNITGADCVTRSIGEPFDHDDVYISYLPLAHIFDRIFEELFISHGSKIGFWRGDVKLL
VDDIAALKPTVFCAVPRVLDRIYSGLTGKISSGGILKKALFNIAYKLKLDSMRKGIKHEK
AAPFFDKLVFSKVKERLGGKLRFIVSGGAPLSVAVEEFLRVVTCASVVQGYGLTETGAAS
FVAIPNDFSMVGTVGPPVEHLDARLESVPEMGYDALSSIPRGEVCVKGSVLFSGYYKRED
LTQEVMIDGWFHTGDVGEWQPNGSLKIIDRKKNIFKLSQGEYVAVENLENVYGVLQEIDS
IWIYGNSFESFLVAVINPNQQVLEHWAEQNGISGSLSELCENSRAKEYILSELTKIAKEK
KLKGYEFIRAVHLDPLPFDMERDLITPTYKKKRPQLLKHYQGTIDALYKMAK
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgatgaagcacttggtggagtcggagaaggcggcggagaatgccgggccgacgtaccgg
aacgtgctggccaaggacgccgggcttctgcggccgccgccgggggtcgagagctgctgg
gacgtcttccgcaattcggtggagaagtacccggacagcccgatgctcggtcgccggaga
gtcgtcgacgacggcaaggcaggtgaatatgtttggatgacttacaaggaggtttatgac
gttgtgatgaaacttgctgcctccattagcaagtcaggaatcagcaagggtgaaagctgt
ggcatctacggcgcaaactgccctgaatggatcatcagcatggaggcttgcaatgcactt
ggggtttcatgcgtgcctctctatgatagtcttggtgctggtgcagtggagtttatcgtg
tgccatgctgaaatccagattgcttttgtggaagagagaaaaatcgcagagctcttgaaa
acttgtcatgccacatcaaagtatttgaagacaatcatcagctttggaggtgtgacaaat
gaccaaaaagaggaggctaaaaatcatgggatgtccatattctcatgggaggaattcctg
atcatgggaggtgatcatcattttgatcttcctgaaaagaagaaatctgacatctgcaca
ataatgtacacaagcgggacaactggagaccctaaaggtgttatgatatcaaatgaaagc
cttcttgttaacatcactggtgctgattgcgtgaccaggtctattggcgaaccttttgat
catgatgatgtttatatatcgtatcttccactggctcatatctttgatagaatctttgaa
gaattattcatttcacacggatcaaaaattggattttggcgtggggacgtcaagctgttg
gtcgatgacattgcagctctaaaaccaacagtattctgtgcagttccacgagtacttgat
agaatatactcaggtcttacaggaaagatctcgtctggtggcatactgaagaaagcttta
ttcaatattgcttacaagctgaaactggacagcatgaggaaaggaattaaacacgagaaa
gcagctccattttttgacaaattagttttcagcaaggtgaaagaaagactgggtggaaaa
ctacgttttatcgtgtctggtggtgcccctttatctgtagcagtggaagaatttttgagg
gttgtgacatgtgcaagtgttgttcaaggctatgggctcacggaaactggtgcggcgtca
tttgttgcaataccaaatgatttttccatggttgggactgttggtccaccagttgagcat
ttggatgcacgtcttgagtcagttccagagatgggctatgacgctttgtcgagcattcct
cgtggagaggtatgtgtaaaaggaagtgttctattctcaggatactacaaaagggaggat
cttacacaggaagtcatgattgatggatggttccacacaggggatgttggcgagtggcaa
ccaaatgggtccttgaaaatcattgacaggaagaaaaatatattcaagctttcacaggga
gaatatgttgcagtagaaaatctcgagaatgtgtacggggttctccaagagatagattcg
atatggatttacggaaatagttttgaatctttccttgttgctgtcataaatcccaaccaa
caagttcttgagcattgggctgaacaaaatggtatctctggaagtttatctgaattatgt
gaaaattcaagagctaaagaatatattctttcagaactcacgaagattgcaaaggaaaag
aagctgaaaggctatgagttcataagagctgtacatcttgacccattaccatttgatatg
gagcgtgatcttataaccccaacatacaagaagaaacgaccacagttgcttaagcactat
cagggaaccattgacgcactctacaagatggcaaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349764
Entry
4349764           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4349764
   00071 Fatty acid degradation
    4349764
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4349764
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4349764
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349764
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4349764
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4349764
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4349764
  Exosomal proteins of breast cancer cells
   4349764
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF3572
Other DBs
NCBI-GeneID: 4349764
NCBI-ProteinID: XP_015617433
UniProt: Q2RAL6 Q0IUN1
LinkDB
Position
11:complement(2131920..2141393)
AA seq 709 aa
MRGNGRGREEEGNSPMGRRLRAVSAHLLPPASTTTTTGGVDLAANPTAGEYAHVQGYSAV
LPEKLQTGKWNVYRNAKTPLRLIDRFPDTPDIATLHDNFVYAVETFRDCRYLGTRICADG
TVGDYKWMTYGEASTNRTAIGSGLIYHGIPEGACIGLYFINRPEWIIVDHACAAYSFVSV
PLYDTLGPDAVQFIVNHATVEAIFCVPQTLSTLLSFITQMPCVRLIVVIGGDNANMPSTP
TSTGVEIIIYSRLLNQGKMSSRPFRPPKPEDVATICYTSGTTGTPKGVVLSHRNLIANVA
GSSVVIKFYPSDVYISYLPLAHIYERVNQIALLHYGVAIGFYQGDNLKLMDDLAALRPTV
FSSVPRLYNRIYAAITNAVKESGGLKERFFHAAYNAKRQAIMNGRNLSPMWDKLVFNKIK
ARLGGRVRLMSSGASPLSADVMEFLRVCFGCLVIEGYGMTETSCVIATMDCDDRLIGHVG
PPNPSCEIKLVDVPEMNYTSEDQPYPRGEICVRGTTIFFGYYKDEIQTREVIDEDGWLHT
GDIGLWLPGGRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFIAQCFIYGDSLNSSLV
AVVAVEPEVLKAWAASEGIQYEDLRQLCADTRARAAVLADMDSIGKEAQLRGFEFAKAVT
LVAEPFTLENGLLTPTFKIKRPQAKAYFAKEIADMYAQLREAESTKSKL
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgcgaggcaacggcagggggcgggaggaggaggggaactccccaatgggccgccggttg
cgggccgtctcggcccacctcctgccgccggcgtccaccaccaccaccaccggcggcgtt
gacctcgccgccaaccccaccgccggcgagtacgcgcacgtgcagggctacagtgctgtg
ctccctgagaagttgcagaccgggaagtggaatgtataccggaatgcgaagacacctctt
aggttaatagatagattccctgatacccctgatattgcaacgcttcatgataatttcgtg
tatgcagttgagacctttagggactgtagatacctgggcacaagaatctgcgctgatgga
acagttggggactacaaatggatgacatatggagaagctagtacaaacaggactgcaata
ggttctggtcttatttatcatggaatacctgaaggtgcatgcattggtttgtattttata
aacagacctgagtggatcatagttgatcatgcctgtgcagcatattcattcgtgtctgtg
ccactttatgacactcttggtccagatgcagttcagttcattgtcaaccatgcgacagta
gaagctattttctgtgtgcctcaaacactaagcactctgttaagctttataactcaaatg
ccatgtgttcgccttatagtggtaattggtggagacaatgcaaatatgccatctacccca
acatctactggagtggaaattataatttactccagactactcaaccagggaaagatgagt
tctagaccttttcgtcctccaaaacctgaagatgttgccactatttgttacactagtggc
acaaccggcacaccaaagggagttgttctttctcataggaacttaatcgcaaatgtagca
ggatcaagtgtggtcattaagttttacccatctgatgtgtacatctcatatctaccttta
gctcacatctatgagagagttaaccagattgcactgcttcactatggagttgccattgga
ttctaccaaggggataatttgaagctgatggatgatctggctgcactgagaccaacagta
ttttctagcgtaccccggctatataacagaatttatgctgcaattacaaatgctgtgaag
gagtctggagggttgaaagaaagattttttcatgctgcatacaatgctaagaggcaagcc
attatgaatggacgaaatctgtccccaatgtgggacaaattggtatttaacaaaataaaa
gctaggcttggtggacgtgtgaggcttatgtcttcaggtgcttctccattgtcagcagat
gtcatggaattcctaagagtatgcttcggttgtctcgtaattgaaggatatggaatgaca
gagacatcctgtgtcatcgctacaatggattgtgatgataggttaattggtcatgttgga
cctccaaatccatcttgtgagattaagctagtggatgtcccagaaatgaattacacctct
gaggatcaaccatatcctcgtggagaaatttgtgttaggggaactacgatattttttggt
tactataaggatgaaatccaaacgagagaggtcattgatgaggacggttggttgcacact
ggagacataggtttgtggctgcctggagggcgtttaaaaattatagataggaaaaagaac
attttcaagttagctcaaggagaatacatagctcccgagaagattgagaatgtctatgct
aagtgcaagtttattgcgcagtgctttatatatggtgatagtttaaactcttctttggtt
gccgtagtagcagttgaaccagaggtgttgaaggcttgggctgcatcggaaggaatccag
tacgaggatttaagacagctatgcgctgatacaagggcaagagctgctgtcctggctgac
atggactctattggaaaggaggcacagctaagaggttttgaatttgccaaagctgttacc
cttgttgctgagcctttcacactagaaaatggtctcctcaccccaacattcaagatcaaa
agaccgcaagctaaggcatactttgcaaaagaaatcgcagatatgtacgcacaactgcgt
gaagcagaatcaacaaagtccaagttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349889
Entry
4349889           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 9, chloroplastic
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4349889
   00071 Fatty acid degradation
    4349889
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4349889
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4349889
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349889
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4349889
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4349889
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4349889
  Exosomal proteins of breast cancer cells
   4349889
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF92
Other DBs
NCBI-GeneID: 4349889
NCBI-ProteinID: XP_015616863
LinkDB
Position
11:3372441..3377878
AA seq 697 aa
MNPYFIGFAIPFLASLLFTKRKGEKKRGVPVDVGGEPGYVIRNHKFERPVETHWEGVSTL
AELFEQSCEQYVYMPLLGTRKLISREMEAARDGRSFEKLHLGQYEWKSYADAFKTVCNFS
SGLVRIGHQRDERVAIFADTRAEWQIALQACFRQSITVVTIYSSLGEGALCHSLNETEVT
TVICGRKELKKLLDISGQLDTVKHVIYVNEEGVSSEVSLAQKCTSWRVESFEEVERLGLE
TPVEAKLPLPSDTAVIMYTSGSTGMPKGVMMSHRNVLAVVSAVMTIVPALGKKDVYLAYL
PLAHILELAAETVMSAVGASIGYGSPLTLTDTSNKIKKGTQGDASALKPTLMTAVPAILD
RVRDGVRKNVDAKGGAAKKLFDIAYSRRLAAINGSWFGAWGLEKHLWDMLVFQKVRAILG
GRIRFILSGGAPLSGDTQRFINICLGAPIGQGYGLTETCAGGTFSEYDDNSVGRVGAPLP
CSYIKLIDWAEGGYLTNDSPMPRGEIVIGGPNVTKGYFKNEAKTNEVYKDDERGMRWFYS
GDIGRLHPDGCLEIIDRKKDIVKLQHGEYVSLGKVEAALSVCPYVDNIMIHADPFHNYCV
ALVVVAHSELKSWASQQGITYSDVSDLCEKQETVKEVLQCLAKAAKQARLEKFEIPAKVK
LVPEPWTPESGLVTAALKLKREAIKKAYEDDLAALYS
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgaatccttatttcatcggcttcgctatcccttttctggcatctctgctgttcaccaag
aggaagggtgaaaagaaaaggggagtgccggttgatgtgggcggagagcccggctatgtg
atccgtaaccacaagttcgagcggcccgttgaaacgcactgggaaggggtttccacgctt
gcggagctgtttgagcagtcctgcgagcagtatgtctacatgccactccttggcaccaga
aagctcatttcgagggaaatggaggcagcccgcgatgggaggtcctttgagaagcttcat
ttggggcagtatgagtggaaaagctatgctgatgcattcaagactgtctgcaacttctca
tctggtttagtgcgaattgggcaccagagggatgagcgtgttgctattttcgccgataca
cgggccgagtggcagattgcattgcaggcatgcttcagacaaagtattacggttgtcacc
atttattcctccttgggcgagggagcgttatgtcactcactaaacgagactgaggtaact
actgtgatatgtggaaggaaagaactgaaaaaacttcttgacataagtgggcaacttgat
actgtgaaacatgtcatctacgtaaacgaggaaggcgtctctagtgaagtatccttagct
caaaaatgcaccagctggagggttgagtcatttgaggaggtagagaggttaggattggaa
acacctgtagaagcaaagctgcctcttccgtcagatactgcggtgataatgtatacaagt
ggcagcactggaatgcccaagggagtcatgatgagccatcgcaatgtcctggctgttgta
tcagctgttatgaccattgtgcctgcacttggcaagaaggatgtctacttggcatacctc
ccattagcacacattcttgaattagcagctgagacagttatgtctgctgttggggcttct
atagggtatggatcaccactgaccctgactgatacatcaaataaaataaagaaggggact
cagggcgatgcttcagctctgaagccaacacttatgactgcagtacctgctatacttgat
cgtgttcgtgatggtgttagaaaaaatgttgatgcaaagggtggtgcagcaaagaaacta
tttgatattgcctatagccgtcggttagctgctatcaatggaagttggtttggtgcatgg
ggattagagaagcatttgtgggatatgcttgtctttcagaaggtgcgtgcgatcttggga
ggaaggattcgatttatactttcaggtggagcacctctgtctggagatactcagagattt
atcaatatatgccttggggctccaatagggcaaggatatggtcttactgaaacatgtgct
ggcgggacattttccgagtatgatgacaattctgttggccgtgttggtgctccattgcct
tgctcatacattaagttgatagattgggctgaaggtggatatttaactaatgattcacca
atgcctcggggtgaaatagttattggaggtccaaacgtgacaaaaggctactttaagaat
gaggcaaaaacaaatgaagtctacaaggatgatgaaagaggcatgcggtggttctattct
ggtgacattggacgtttgcatccagatggttgccttgaaattattgaccgtaagaaggac
atagtcaagcttcaacatggtgaatatgtatctttaggaaaggtggaggctgctttgagt
gtgtgcccatatgttgacaacatcatgatccatgctgaccccttccacaactactgcgtt
gcacttgttgtagttgcacacagtgaactgaaaagctgggcctcacaacaaggcatcacg
tattcggatgtttcagatttgtgtgagaagcaagagactgtcaaagaagtccttcaatgt
ttagcaaaggctgccaagcaagcgcggctggagaagtttgagatcccagccaaagtcaag
ctggtgccggagccatggaccccagagtcaggactcgtcacggctgccctcaagctcaag
agggaggccatcaagaaggcgtacgaggatgaccttgcggcgttatacagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350728
Entry
4350728           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4350728
   00071 Fatty acid degradation
    4350728
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4350728
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4350728
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4350728
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4350728
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4350728
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4350728
  Exosomal proteins of breast cancer cells
   4350728
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4350728
NCBI-ProteinID: XP_015616841
UniProt: Q2R2L5 B9GB73
LinkDB
Position
11:20743700..20748466
AA seq 661 aa
MEETYTVKVGEATPAAGGKPSAGPVYRSIYSKDGLMKLPEDILSPWDFFSGAVKQYPKNK
MLGQRKVSDGKAGDYVWLTYEEVYQKVIKIGSAIRSLRVKPGGHCGIYGSNCPEWVMAMQ
ACNSQGICYVPLYDTLGANAVEFIMDHAEISIAFVQESKIQSVLSVVKRCRAHIKAIVSF
GDVTSELKREAEQLGVSCFSWEEFSSMGKQNYELPKKQKDDICTIMYTSGTTGDPKGVII
TNRALIAGVMTTEHLLKVTDKVVAEDDSYFSYLPLAHIFDQVIGNYCISKGASIGFWQAD
IRYLMEDVQMMKPTVFCGVPRVYDRIYTGINQKIQSGGMIAKSLFQYAYNYKLGNLRKGL
KQDEASPFFDKIVFSKIKEGLGGRIRLLLSGAAPLPRHVEEFMRVTSCSVLVQGYGLTES
CSGCFTSIANVFSMIGSVGPPVTTIEARLESIPEMGYDALSNVPRGEICLRGHTLFSGYY
KRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLESAYVQSP
LVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNKTGNFAELCNDPKARMYIQDELNKT
GKRLGLRGFEMLKAIHLETTPFSIEKDLVTPTFKLKRPQLLKYYKDCIDQLYKDAKVGNK
Q
NT seq 1986 nt   +upstreamnt  +downstreamnt
atggaggagacgtacaccgtgaaggtgggtgaagcaactccggccgccggcggcaagccg
tcggccgggccagtctaccggagcatctactccaaggatggcctcatgaagctccctgaa
gatatcctgtccccttgggacttcttcagtggagcagtcaagcagtaccccaagaacaag
atgctgggccagcgcaaagtttcagatggcaaggctggtgactatgtgtggctaacatat
gaagaagtgtaccagaaggtcattaagattggatcagccatcagaagcttacgtgtcaag
ccgggtggtcactgtggcatatatggatcaaactgtccagaatgggttatggctatgcag
gcttgcaacagccaaggaatatgctatgttccactgtatgacacccttggtgcaaatgca
gttgaattcataatggatcatgctgagatctctatagcatttgtgcaggaaagcaagata
caatcagtattatctgtagtcaagaggtgcagagcccacatcaaagcaatagttagtttt
ggagatgtgacaagtgaactgaaaagagaagctgaacagttaggagtatcttgcttttct
tgggaagaattttcttcaatgggaaagcaaaactatgaacttcccaagaaacaaaaggat
gacatttgcacaatcatgtatacaagtggaacaactggagacccgaagggtgtgataatc
acaaacagagctctaattgccggtgttatgaccacagaacatcttctgaaagtgacagac
aaagtggtggctgaagatgattcctacttttcctatctcccattagctcacatatttgat
caagtaattggaaactactgcatttctaaaggagcctccattggattctggcaagcggac
attaggtatctcatggaggatgtgcaaatgatgaaaccaacggtattttgtggtgtccct
cgtgtttatgatcgtatatacacaggtattaatcagaaaattcagtctggagggatgata
gccaaaagccttttccagtatgcatacaactacaaacttggaaatttgcggaaagggttg
aaacaggatgaagcctcgccattttttgacaaaatagttttcagtaaaataaaagaaggg
cttggaggccggatacgactccttctatcaggagcagcacctttgccaagacacgtcgaa
gaattcatgcgggttaccagctgcagtgtacttgtacaaggatatgggctaacagagagt
tgctcaggatgcttcacatcaatcgccaatgttttctcaatgattggatcagttggtcct
cctgtgacgacaatcgaggcacggttagaatccattccagaaatggggtatgacgcactc
tcaaatgtgcctaggggtgagatctgcttgaggggtcacaccttgttctccgggtactac
aagcgccctgacctcaccgaggaagtattctcagatggttggttccatacaggtgatatc
ggtgagtggcaaccagacggcacaatgaagatcatcgacagaaagaagaacattttcaag
ctgtcccaaggggagtatgtagcagtggaggtcctggaaagcgcatacgtgcagtctcct
ctcgttacatcagtttgggtctatggaaacagctttgagtccttccttgttgctgtggtt
gtccctgagaagcaggccattgaggattgggctgcacaaaacaacaagactggtaacttt
gcagaattgtgcaacgatccgaaggcaagaatgtacatacaggatgagctaaacaaaact
ggcaaaagactagggttgagaggatttgagatgctaaaggcaattcacctagagacaacg
ccattcagcatagagaaggacctggtgactccaacttttaagctcaagagaccccagctg
ctcaaatattacaaggattgcattgatcagctgtacaaggatgccaaggtgggaaataaa
cagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351483
Entry
4351483           CDS       T01015                                 
Name
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00071  Fatty acid degradation
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4351483
   00071 Fatty acid degradation
    4351483
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4351483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4351483
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351483
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     4351483
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   4351483
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4351483
  Exosomal proteins of breast cancer cells
   4351483
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF3572 Smoa_sbd
Other DBs
NCBI-GeneID: 4351483
NCBI-ProteinID: XP_015620538
UniProt: B9GBV0 Q2QXT1
LinkDB
Position
12:complement(2161561..2170099)
AA seq 707 aa
MARQQQQREEERAPMGAAQRRLRAVSGHLQPPTESGGVDLAANPTAGEYAHVQGYSAVLP
EKLQTGKWNVYRSAKSPLKLINRFPDNPDIGTLHDNFVYAVETFRDCRYLGTRVCVDGTV
GDYKWMTYGEASTSRTAIGSGLIYHGIPEGARIGLYFINRPEWTIVDHACAAYSYVSVPL
YDTLGPDAVQFIVNHATVQAIFCVPQTLSTLLSFITQMPCVRLIVVIGGDNANMPSTPTA
TGVEIITYSRLLSQGKMSSQSFRPPKPEDIATICYTSGTTGTPKGVVLSHGNLIANVAGS
SLVIKFYPSDVYISYLPLAHIYERVNQVSVVHYGVAIGFYQGDNLKLMDDLAALRPTVFP
SVPRLYNRIYAAITNAVKESGGLKERLFHAAYNAKRQAIINGRNPSPMWDRLVFNKIKAR
LGGRVRLMTSGASPLSADVMEFLRICFGGEVLEGYGMTETSCIISAMNIGDRLIGHVGSP
NPSCEIKLVDVPEMNYTSEDEPYPRGEICVRGPTIFCGYYKDEIQTREAVDEDGWLHTGD
IGLWMPGGRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFIAQSFIYGDSLNSSLVAV
VAVEPDVLKAWAASEGIQHEDLRQLCADPKARSAVLAEMDSIGKEAQLRGFEFAKAVTLV
AEPFTLENGLLTPTFKVKRPQAKAYFAKEIADMYAQLRQAEQIKPKL
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggcgcggcagcagcagcagcgggaggaggagagggccccaatgggcgcggcccagcgg
cggctgcgcgccgtctccggccacctccagccgccgacggagtccggcggcgttgacctc
gccgccaaccccaccgccggcgagtacgcgcacgtgcagggctacagtgctgtactccct
gagaagttgcaaactggaaagtggaatgtgtacagatccgcaaagtcacctcttaagtta
ataaatagattccctgataacccagacattggaacgcttcatgataactttgtgtatgca
gttgaaacctttagggactgtagatacctgggcacaagagtctgtgttgatggaacagtt
ggggactacaaatggatgacatatggagaagctagtacaagccggactgcgataggttct
ggtcttatttaccatggaatacctgaaggtgcgcgcattggtttgtattttataaacaga
cctgagtggaccatagttgatcatgcctgtgcggcatattcatatgtatccgtgccactt
tatgatactctaggtccagatgcagttcagttcattgttaaccatgcgacagtacaagct
attttctgtgtgcctcaaacactaagcactctactaagctttataactcaaatgccgtgt
gttcgccttatagtggtaattggtggagacaatgcaaatatgccatctaccccaacagct
actggagtggaaattataacttactccagactacttagccagggaaagatgagttctcaa
tcttttcgccctccaaaacctgaagatattgccactatttgttacactagtggcactact
ggcacaccgaagggagttgttctttctcatgggaatttaattgcaaatgtagcaggatca
agcctagtcattaagttttacccatctgatgtgtatatctcatatctacctttagctcac
atctatgagagagttaaccaggtctcagtggttcactatggtgttgccattggtttctac
caaggggataatttgaagctgatggatgatctggctgcattgagaccaacagtatttcct
agtgtgcctcggctatataatagaatttatgctgcaattacaaatgctgtcaaggagtct
ggagggttgaaagaaagattgtttcatgctgcatacaatgctaagaggcaagcgattatt
aatgggagaaatccgtccccaatgtgggacaggttggtatttaacaaaataaaagctagg
cttggtggacgtgtgaggcttatgacttcaggcgcttctccattgtcagctgatgtaatg
gaattcctaagaatatgttttggtggtgaagtactcgaaggatatggaatgacagagaca
tcatgtatcatctctgcaatgaatattggtgataggttaattggtcatgtcggatctcca
aatccatcttgtgagattaaactagtggatgtcccagaaatgaattacacctctgaggat
gaaccatatcctcgtggagaaatctgtgttaggggacctacgatattctgtggttactat
aaagacgaaatccaaactagagaggctgttgacgaggatggttggttacacactggagac
ataggtttgtggatgcctggagggcgtctaaaaattatagataggaaaaagaacattttc
aagttagctcaaggagaatacatagctcccgagaagattgagaatgtctatgctaagtgc
aagtttattgcgcagtcctttatatatggtgatagtttaaactcttctttggttgccgta
gtagcagttgaaccagatgtgttgaaggcttgggctgcatctgagggaatccagcacgag
gatttaagacagctttgtgctgatccgaaagcaagatctgctgtcctggctgagatggac
tctattggaaaggaagcacagctaagaggttttgaatttgccaaagctgttacccttgtt
gctgaacctttcacattagaaaatggtctcctcaccccaactttcaaggtcaaaagaccg
caagctaaggcatactttgcaaaagaaatcgcagatatgtatgcacaactgcgccaagca
gaacagataaaacctaagctgtaa

DBGET integrated database retrieval system