KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324263
Entry
4324263           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase, cytosolic isozyme
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4324263
   00620 Pyruvate metabolism
    4324263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324263
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324263
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4324263
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4324263
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4324263
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 4324263
NCBI-ProteinID: XP_015619741
UniProt: Q5NBQ0 A0A0N7KCR5
LinkDB
Position
1:complement(9694394..9699812)
AA seq 510 aa
MAVMEEQQEGAAGVMRRRPKTKIVCTLGPASRSVEMIGRLLRAGMCVARFNFSHGSHEYH
QETLDNLRAAMESTGILCAVMLDTKGPEIRTGFLKDGKPVQLKKGQEITVSTDYSIKGDD
NMISMSYKKLAVDLKPGSVILCADGTITLTVLHCDKEQGLVRCRCENTAMLGERKNVNLP
GVIVDLPTLTEKDKEDILKWGVPNKIDMIALSFVRKGSDLVEVRKVLGKHAKSIMLMSKV
ENQEGVANFDDILAQSDAFMVARGDLGMEIPIEKIFYAQKVMIFKCNIQGKPVVTATQML
ESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICLQAESCVDH
AAVFKSITASAPIPMSPLESLASSAVRTANSAKAALILVLTRGGTTARLVAKYRPSMPIL
SVVVPELKQTDSFDWTCSDEAPARHSLIVRGVIPMLSAATAKAFDNEATEEALGFAISNA
KAMGLCNSGESVVALHRIGTASVIKLLTAN
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggcggtgatggaggagcagcaggagggagccgcgggggtgatgcggcggaggcccaag
acgaagatcgtgtgcacgctggggccggcgtcgaggtcggtggagatgatcgggcggctg
ctccgcgccgggatgtgcgtcgcgcgcttcaacttctcccacggatcccacgagtaccac
caggagacgctcgacaacctccgcgccgccatggagagcaccggcatcctctgcgccgtc
atgctcgacaccaaggggccagagatccgaactggatttctgaaagatggaaaacccgta
cagttgaagaagggtcaagaaatcacagtttcaactgattatagcataaagggtgatgac
aacatgatatcaatgagctacaagaagctagcggtggatctgaagccaggcagtgtaata
ttatgtgctgatggcaccatcactcttactgtccttcactgtgataaagagcaaggcttg
gttcgctgccgttgtgagaacactgctatgcttggtgagaggaagaatgttaaccttcca
ggagttattgttgatctcccgacacttactgagaaggacaaggaggatattcttaaatgg
ggtgtcccaaacaagattgacatgattgctctgtcttttgttcgtaaaggctcagacctt
gtagaggtcaggaaggtgcttgggaagcatgcaaagtcaataatgctgatgtcaaaggtt
gagaatcaagagggagtggctaactttgatgatatcctggcacaatctgatgcttttatg
gttgcaaggggtgatttgggaatggaaattccgatagagaagatcttttatgcacagaag
gtgatgattttcaagtgcaatattcagggcaagccagttgtgactgcaacccagatgttg
gaatctatgatcaagtctccccgccctactagagcagaagcgactgatgttgccaatgca
gttcttgatggcactgactgtgtcatgctcagtggtgagacagctgctggggcttacccg
gaactggctgtacggaccatggccaagatctgcctgcaagcggagtcatgcgtcgaccat
gccgctgttttcaagtccattaccgcatcagctccaattcccatgagcccattggagagc
cttgcatcatcagctgtgcgtacagcgaactctgccaaggcggcgctcatcttggtcctg
actaggggaggaacaactgctaggctggtggccaagtacaggccatccatgccgattctg
tccgtcgtggttcctgagctgaaacagaccgactccttcgactggacctgcagcgacgaa
gctcctgcgcggcacagcctcatcgtcaggggagtgatcccgatgctgagtgcagccact
gccaaggccttcgacaacgaagccactgaagaagctctcgggttcgccatcagcaacgcc
aaggcgatggggctctgcaactccggtgagtccgtcgtcgccctccaccggatcggaact
gcatctgtcatcaagctcctgacagcgaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327173
Entry
4327173           CDS       T01015                                 
Name
(RefSeq) plastidial pyruvate kinase 2
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327173
   00620 Pyruvate metabolism
    4327173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327173
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327173
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4327173
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4327173
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4327173
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI Cellulase
Other DBs
NCBI-GeneID: 4327173
NCBI-ProteinID: XP_015622342
LinkDB
Position
1:complement(26888395..26895779)
AA seq 583 aa
MAQVVAAAGTAAAVAAVGRPLGGGGSGADALRPAARLSFAPRWCGGSAGAARARRESAVT
SVISRAPRLDAEVLPVSADDDADVKEEENFQHLKAIQQLATSANGVWSKPNVRRKTKIVC
TIGPSTNTKEMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKEYNAQTKDNVIAIMLDT
KGPEVRSGDLPQPIMLETGQEFTFTIKRGVGTETCVSVNYDDFVNDVEVGDMLLVDGGMM
SLLVKSKTEDSVKCEVIDGGELKSRRHLNVRGKSATLPSITDKDWDDIKFGVENQVDYYA
VSFVKDAQVVHELKDYLRSSNADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAEL
PIEEVPLLQEEIIRMCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDGIML
SGETAHGKFPLKAVKVMHTVALRTEATMSGGETPANLGQVFKNHMSEMFAYHSTMMSNTL
GTSIVVFTRTGFMAILLSHYRPSGTIFAFTDQERVRQRLALYQGVCPVQMEFSDDAEKTF
GDALSYLLKHGMVKEGEEVALVQSGRQPIWRSQSTHNIQVRKV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcgcaggtggtggctgcggcagggacggcggcggcggtggcggcggtggggaggccg
ctgggtggcggcggatctggggccgacgcgctccgcccggcggcgaggctgtcgttcgcg
ccgcgctggtgcggtgggagcgcgggggcagcaagggcgcgccgcgagtccgccgtcacg
tccgtgattagccgcgccccgcgtctcgacgccgaggtgctgccggtgtcggccgacgac
gacgcggacgtgaaggaagaagaaaacttccagcatctcaaggccattcagcaacttgca
acatcagccaatggtgtgtggtctaaaccaaatgtgagacgcaagacaaagatcgtgtgc
accattggtccttcaactaacacaaaggagatgatatggaaacttgctgaggctggcatg
aatgtggctcggcttaatatgtcacatggagaccatgcatcacaccagaaagttattgac
ttagtaaaggaatataatgctcaaacaaaggataacgtgattgctattatgcttgacacg
aagggaccagaagttaggagtggagatttgcctcaaccaataatgttggaaactggccag
gagttcactttcacaattaagagaggagttgggactgagacatgtgttagcgttaactat
gatgactttgttaatgatgtagaagtgggtgacatgctcctcgtagatggtggaatgatg
tcgttgttggtcaagtccaaaactgaagattcggtaaaatgtgaagttattgatggaggt
gaactgaaatccaggcgtcacctgaatgttcgtggaaagagcgcaaccttgccatcaata
actgacaaggattgggatgatattaagtttggtgtggagaatcaagttgactactatgcc
gtttcttttgtcaaagatgctcaagttgtgcatgaattgaaggattatctcagaagctcc
aatgccgatatacatgtaattgtaaagattgaaagtgcagattccattccaaacctacac
tcaatcatcacagcatcggatggggctatggttgccagaggtgacttgggagctgaactc
cctattgaggaggtaccgctgctgcaggaagaaattattagaatgtgcaggagcatggga
aaagctgttattgttgccactaatatgctagaaagtatgattgttcatccaactccaacc
cgagcagaagtttcagacattgctatagctgttcgagaaggttctgatggcattatgctt
tctggggaaactgcacacggaaagtttcctttgaaagctgttaaggtcatgcatactgtt
gccctgagaactgaagccactatgtctggtggggaaacaccggctaaccttggtcaggtg
ttcaagaatcacatgagtgaaatgtttgcataccattcaacaatgatgtccaacactctt
ggaacatcaattgtggttttcaccaggacaggatttatggctatcctacttagtcattac
cgcccttctggcaccatttttgcctttacggaccaggagagagttagacaacgattggct
ttgtaccaaggtgtatgtccagtccagatggaattttctgatgatgctgagaagacattt
ggtgacgctttgtcatacttgctgaaacatggtatggtgaaggaaggcgaggaggttgca
cttgttcaaagtggcaggcaacctatctggcggtcgcagtccacccataatattcaggtc
aggaaggtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333694
Entry
4333694           CDS       T01015                                 
Name
(RefSeq) plastidial pyruvate kinase 1, chloroplastic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4333694
   00620 Pyruvate metabolism
    4333694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333694
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4333694
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4333694
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4333694
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4333694
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI DnaB_C
Other DBs
NCBI-GeneID: 4333694
NCBI-ProteinID: XP_015633267
UniProt: Q0DPQ1 Q84R73
LinkDB
Position
3:complement(26526607..26530732)
AA seq 548 aa
MATSAAAAASTLPYLVAAASSSAAARRRGAHRIRASSAAAEVEGAMDVVSEAELREKGFM
GLRKTKLVCTVGPACVGALPALARGGMGVARVNLCHGGRGWHRAVMREVRRLNEEEGFCV
SLMVDTEGSQLLVADHGGAASVKAEDGSEWLFTSKRTDESHPFTMHVNFDKFSEDILVGD
ELVIDGGMATFEVIEKVGNDLRCKCTDPGLLLPRAKLSFWRNGKLVERNFGLPTLSAKDW
ADIEFGIAEGVDCIALSFVKDANDIKYLKTYLSRKSLEHIKIFAKVESLESLKNLKDIIE
ASDGVMVARGDLGVQIPLEQIPAIQEAIVDLCRRLNKPVIVASQLLESMVEYPTPTRAEV
ADVSEAVRQYADAVMLSAESAIGAYPQKALAVLRAASERMESWSREENMQKLLPQHQLAI
ALPDRISEQICTSAAEMANNLAVDAIFVYTKYGHMASLLSRNRPNPPIFAFTDNANSRKS
MNLYWGVIPLQLPLSNNMEDNFNQTIKLMKSKGSVKSGDTVLVVADSDLNRPRAATSVFQ
SIQVRIVD
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcaacctccgccgccgccgccgcgagcaccttgccttacctcgtcgccgccgcctcc
tcctccgcggcggcgcgccgccgcggggcccaccggatccgggcgtcgtcggcggcggcg
gaggtggagggggcgatggacgtggtgtcggaggcggagctgcgggagaaggggttcatg
gggctccggaagacgaagctggtgtgcacggtggggcccgcgtgcgtgggggctttgccg
gcgctggcgcgcggcgggatgggcgtggcgcgggtcaacctgtgccacgggggccgcggc
tggcaccgcgccgtgatgcgcgaggtgcggaggctcaacgaggaggaaggcttctgcgtc
tccctcatggtcgacaccgaggggtcccagctcctcgtcgccgaccacggcggcgccgcc
tccgtcaaggccgaggatggctctgaatggctatttacaagtaaaagaaccgatgaatct
catccattcacaatgcatgttaactttgataagttttctgaagacattctagttggtgat
gagcttgtaattgatggaggaatggcaacatttgaagttattgagaaggtcggaaatgat
ttgcgctgtaagtgcacagacccaggtttgcttcttcctcgagccaaactgtcattctgg
aggaatggaaaattagttgaaaggaactttgggcttcctacattgtcagcaaaggattgg
gctgacattgaatttgggatagctgaaggagttgattgcatcgctctttcatttgtaaaa
gatgctaatgacatcaagtatctcaagacttacctctccagaaaatcattagaacacatc
aaaatattcgcgaaggttgagagtcttgaatcactcaagaaccttaaagacatcatagag
gcatctgatggagttatggtagcacgtggtgatcttggagttcagattcctttagaacaa
atcccagccatccaagaggcaattgttgatctttgtcgacggttgaacaagccagtgata
gttgcctctcagcttcttgaatcaatggttgagtatccaacaccaactcgtgcagaggta
gcagacgtttctgaagcagtacggcaatatgctgatgccgtaatgttatcggcagagtca
gctataggtgcatatccccagaaagctctagcagtcctccgtgctgctagtgagaggatg
gaatcatggagccgtgaggaaaacatgcagaaacttcttccacaacatcagcttgcaata
gctttgcctgataggatctcagagcaaatttgcaccagtgctgcagaaatggcaaacaac
cttgcggtggatgccatctttgtttacacaaagtatggtcacatggcgtcgcttctttcg
cgcaaccggcccaaccctcccatttttgctttcactgataatgccaactcaagaaagagc
atgaacctctactggggagtaattccacttcagctaccactgtcaaataacatggaagat
aacttcaatcaaaccatcaagcttatgaagtcgaagggttcagtgaaatctggagacaca
gtcttggtcgtcgccgactctgatctgaaccgaccccgtgctgctacctcagttttccaa
tccattcaagttcgaatagtggactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337406
Entry
4337406           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase, cytosolic isozyme
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337406
   00620 Pyruvate metabolism
    4337406
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337406
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337406
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4337406
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4337406
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4337406
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 4337406
NCBI-ProteinID: XP_015635772
UniProt: Q7XKB5 Q0J908
LinkDB
Position
4:complement(34605338..34609122)
AA seq 511 aa
MANIDMGKILAGLENDDARVPKTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHE
YHQETLDNLRQAMHNTGVLCAVMLDTKGPEIRTGFLKDGKPIKLTKGQELTVTTDYEIKG
DENMITMSYKKLPVDVKPGNVILCADGTISLTVLSCDPKAGTVRCRCENTAMLGERKNCN
LPGIVVDLPTLTEKDKEDILGWGVPNDIDMIALSFVRKGSDLVTVRQLLGQHAKRIKLMS
KVENQEGVVNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKPVVTATQ
MLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEVAVKIMARICVEAESSL
DNEAVFKEMIRSAPLPMSPLESLASSAVRTANKAKAALIVVLTRGGTTAKLVAKYRPRVP
ILSVVVPVLTTDSFDWTISSEGPARHSLIYRGLVPLLAEGSAKATDSESTEVILDAALKS
AVQKQLCKPGDAVVALHRIGVASVIKICIVK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgaacatcgacatggggaagatcctggcggggctggagaacgacgacgcgcgggtg
cccaagaccaagctggtctgcacgctcggcccggcctcccgctccgtccccatgctcgag
aagctgctccgcgccgggatgaacgtcgcgcgcttcaacttctcccacggcacccacgag
taccaccaggagaccctcgacaacctccgccaggccatgcacaacaccggcgtcctctgc
gccgtcatgctcgataccaagggtcctgagattcgtactggatttttgaaggatggcaag
ccaatcaagctaacaaagggtcaagaactcactgttaccaccgattatgagatcaagggt
gatgagaacatgattaccatgagttacaagaaactgccagttgatgtgaagcctggaaat
gtcattctctgcgccgatggtacaatctctttgactgttttgtcctgtgatccaaaggct
ggaactgtgaggtgtaggtgtgagaacacagcaatgcttggcgagagaaagaattgcaat
ctgccaggaattgttgtggaccttcctacactgactgagaaggataaagaagacattttg
ggatggggtgtgccaaatgacatagacatgattgctctgtcgtttgtccgtaaaggatca
gatttggttaccgtcagacaacttcttggacagcatgcaaagcgcatcaagctgatgtca
aaggttgaaaaccaagagggtgttgtaaacttcgatgagatcttgagggaaacggatgca
tttatggttgctagaggtgatcttggaatggagattccagttgagaagatattccttgca
cagaagatgatgatttacaagtgcaaccttgctggaaagcctgttgtgactgctactcag
atgcttgagtcgatgatcaaatcaccacgtccaactcgtgctgaggcaactgacgttgca
aatgcagttcttgatggaactgactgcgtcatgcttagtggagagagtgctgctggagca
taccctgaagtagctgtgaagatcatggcacgtatatgtgttgaggcagagtcttccctt
gacaacgaagctgtcttcaaggagatgatcaggtctgcgccccttccgatgagcccattg
gagtctctcgcatcctctgctgtacgcacagccaacaaggccaaggcagccctgattgtt
gtcttgactcgtggtggtaccacggcaaagctggttgccaagtatcgtcccagggttcca
atcctctctgtggttgtccccgtgttgacaaccgattcattcgactggacaatcagctcg
gagggcccagcaaggcacagcctaatctacagaggtcttgttcctctcctggctgagggt
tctgccaaagccaccgattcggagtcgacagaggtcatccttgatgctgctctcaagtca
gctgtacagaagcagttgtgcaagcctggtgatgctgttgttgctctgcaccgtattggc
gtcgcatccgtgatcaagatctgcatcgtgaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339815
Entry
4339815           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 3
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4339815
   00240 Pyrimidine metabolism
    4339815
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4339815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339815
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4339815
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4339815
SSDB
Motif
Pfam: NDK PSI_PsaJ
Other DBs
NCBI-GeneID: 4339815
NCBI-ProteinID: XP_015639333
UniProt: Q5TKF4 A0A0P0WR33
LinkDB
Position
5:complement(29660576..29663526)
AA seq 239 aa
MSKLCQSACKAAKSLLSATAAASSPRTSLLAEGRNAALATLTNLGRKTLPTAYAYSYHHN
SSAAAAGWLAAIPAAVYMLQDQEAHAAEMERTFIAIKPDGVQRGLISEILSRFERKGFKL
VAIKLVVPSKEFAQKHYHDLKDRPFFNGLCDFLSSGPVLAMVWEGEGVIKYGRKLIGATD
PQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKAEIGLWFEPRELVSYTSNEEKWIYGVN
NT seq 720 nt   +upstreamnt  +downstreamnt
atgagcaagctctgccagtcggcgtgcaaggccgccaagtctctcctctccgccaccgcc
gccgcctcctccccgcgcacctccctcctagccgaggggaggaacgcggcgctggccacc
ctcaccaacctggggaggaagaccctccccacagcttacgcctactcctaccaccacaac
tcctccgccgccgccgccggatggctcgctgccatccccgccgctgtttacatgctacag
gatcaggaggcgcatgctgcagagatggagcgcacctttatcgccatcaagcctgacggc
gtccaaaggggcctgatttctgagatactgtcccgatttgaaagaaaaggattcaagctt
gttgccatcaagctggtggttccatccaaagaatttgctcagaagcactatcatgatttg
aaagacagacctttcttcaatggattgtgtgacttccttagctctggccctgtgcttgcc
atggtttgggaaggagagggtgttatcaagtacgggagaaaactgattggtgctacagac
ccacagaagtctgaaccaggaaccatcaggggtgaccttgctgttgttgttggcaggaac
atcatccatggaagcgatggcccagagactgcaaaggctgagattggtctctggtttgag
cccagggagctggtctcttacaccagcaacgaagagaagtggatctacggggtcaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342564
Entry
4342564           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase isozyme A, chloroplastic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4342564
   00620 Pyruvate metabolism
    4342564
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342564
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342564
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4342564
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4342564
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4342564
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI DnaB_C
Other DBs
NCBI-GeneID: 4342564
NCBI-ProteinID: XP_015647744
UniProt: A3BH68
LinkDB
Position
7:4266867..4271499
AA seq 578 aa
MAATAAAAHTLLHLAAPRKPSAGPPLPPATLRLPSRRLARLTASCSSGSGNNSAADFPNP
NGILVAPPSAAAVAAASSHIDVDVATEADLRENGFRSTRRTKLVCTVGPATCGADELEAL
AVGGMNVARVNMCHGDREWHRGVIRAVRRLNEEKGFAVAVMMDTEGSEIHMGDLGGAAAA
KAEDGEIWTFSVRSFEAPPPERTIHVNYEGFAEDVRVGDELLVDGGMARFEVVEKLGPDV
KCRCTDPGLLLPRANLTFWRDGSIVRERNAMLPTISSKDWLDIDFGISEGVDFIAVSFVK
SAEVINHLKSYIAARSRGSDIAVIAKIESIDSLKNLEEIIRASDGAMVARGDMGAQIPLE
QVPSVQQKIVKLCRQLNKPVIVASQLLESMIEYPTPTRAEVADVSEAVRQRADALMLSGE
SAMGRYPEKALSVLRSVSLRIEKWWREEKRHEELELKDVSSSFSDKISEEICISAAKMAN
KLEVDAVFVYTNTGHMASLLSRCRPDCPIFAFTTSTSVRRRLNLQWGLIPFRLSFSDDME
SNLNRTFSLLKARGMIQSGDLVIALSDMLQSIQVMNVP
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggccgccaccgccgccgcggcccacaccctcctccacctcgcggccccgaggaagccc
tccgcggggcccccactcccgcccgccaccctccgcctccccagccgccgcctcgcccgt
ctcacggccagctgcagcagcggctccgggaacaacagcgccgccgacttccccaacccc
aacgggatcctcgtcgcgcccccgtccgccgcggcggtggcggcggcgtcgtcgcatatc
gatgttgacgtggcgacggaggccgacctgagggagaacgggttccggagcacgcggcgc
accaagctcgtctgcaccgtggggcccgccacctgcggcgccgacgagctggaggcgctc
gccgtcggcgggatgaacgtcgcgcgcgtcaacatgtgccacggggaccgggagtggcac
cggggcgtcatccgcgcggtgcggaggctcaacgaggagaaggggttcgccgtcgccgtc
atgatggacaccgaggggagcgagatccacatgggggacctcggcggcgccgccgccgcc
aaggcggaggatggagaaatatggacatttagcgtaagatcctttgaggcacctccccca
gaacgaactattcatgtgaactacgaaggcttcgctgaagatgtgagagttggtgatgag
cttcttgttgatggtggcatggctcggtttgaggtggttgagaaattaggaccagatgtc
aagtgccgttgcacagatcctggtttgttgctgccacgtgccaatcttacattttggcgg
gatggtagtattgtccgtgagaggaacgctatgctacctaccatttcatcaaaggattgg
cttgacatagactttggaatttctgaaggcgtagattttattgcagtttcgtttgtcaaa
tctgcagaagtaattaaccatctgaaaagctatatagctgcaaggagccgtggcagcgat
atagcagtcattgccaagatcgagagcattgactctttgaagaacttggaggagataatc
cgtgcttcagatggtgccatggtagcccgaggggatatgggtgcacaaattcccttggag
caagtcccctcagtacaacaaaagatagttaaactgtgcaggcagctcaacaagccagtc
attgttgcgtcgcagcttcttgaatcgatgattgagtatcctacgcccaccagggccgag
gttgctgatgtttctgaagcagttcgtcagcgtgcagatgcgcttatgctttcaggtgag
tcagcaatggggagatatccagagaaagctcttagtgtcctccggagtgttagcctaagg
attgagaagtggtggagagaggagaagcgccatgaggaactggaacttaaagatgtttca
tcttccttctctgacaaaatatcagaagaaatctgcatttcggccgctaaaatggccaac
aaattggaggtagatgccgttttcgtctacacaaacactggccacatggcctcactgctc
tcgcggtgccgtcctgactgcccgatcttcgccttcacgacctcgacatctgtgaggaga
cgattgaacctccaatggggcctcatccccttccgcctcagcttctcggacgacatggag
agcaacctgaaccgtaccttctcgctgctcaaggccaggggcatgatccagtccggcgac
cttgtcatcgcgctctccgacatgctgcagtccatccaggtcatgaacgtaccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343275
Entry
4343275           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4343275
   00240 Pyrimidine metabolism
    4343275
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4343275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343275
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4343275
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4343275
SSDB
Motif
Pfam: NDK Mycobact_memb
Other DBs
NCBI-GeneID: 4343275
NCBI-ProteinID: XP_015647142
UniProt: Q07661
Structure
LinkDB
Position
7:complement(18335058..18337495)
AA seq 149 aa
MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSFAQQHYADLSDKPFFPG
LVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIRADYAVEVGRNVIHGSDSV
DNGKKEIALWFPEGLAEWRSNLHPWIYES
NT seq 450 nt   +upstreamnt  +downstreamnt
atggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctgattggagac
atcatcagcaggttcgagaagaaaggattctacctgagggggatgaagttcatgaatgtg
gagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctggg
ttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgtt
gttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcacc
atccgtgctgactatgccgtggaagttggcaggaatgtcatccatgggagcgactccgtg
gacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagc
aaccttcacccttggatctatgagtcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349403
Entry
4349403           CDS       T01015                                 
Name
(RefSeq) nucleoside diphosphate kinase 1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
osa04016  MAPK signaling pathway - plant
Module
osa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
osa_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
osa_M00053  Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP
osa_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4349403
   00240 Pyrimidine metabolism
    4349403
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4349403
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349403
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     4349403
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4349403
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 4349403
NCBI-ProteinID: XP_015614147
UniProt: A3C7D3 Q7XC37
LinkDB
Position
10:complement(22257990..22260457)
AA seq 151 aa
MALEQTFIMIKPDGVQRGLIGEVIGRFEKKGFYLKAMKLINVEKSFAEKHYADLSSKPFF
GGLVEYIVSGPVVAMVWEGKQVVSTGRKLVGATNPLAAEPGTIRGDFAVDIGRNVIHGSD
SVENARKEIALWFPEGIAEWRSNQHPWIYEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcgttggagcagaccttcatcatgatcaagcccgacggcgtccagaggggcctcatt
ggcgaggtcatcggccgcttcgagaagaagggattctacctcaaagccatgaagctcatc
aacgtggagaagtcgttcgccgagaagcactacgccgatctgtcctccaagcccttcttc
ggagggctcgtggagtacatcgtctccggccccgtcgtcgccatggtctgggagggcaag
caggtcgtctccaccggccgcaagctcgtcggggccaccaaccccctggccgctgagccg
ggcaccatccgtggcgacttcgctgtcgacattggcaggaatgtcatccacggaagcgac
tcggtcgagaacgccaggaaggagattgctctgtggttccctgagggcatcgccgagtgg
aggagcaaccagcacccatggatctatgaggtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349454
Entry
4349454           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase isozyme G, chloroplastic isoform X1
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4349454
   00620 Pyruvate metabolism
    4349454
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349454
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349454
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4349454
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4349454
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349454
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI TTC5_OB OSK Cellulase IMPDH
Other DBs
NCBI-GeneID: 4349454
NCBI-ProteinID: XP_015614430
UniProt: Q8S7N6 Q0IVH4
LinkDB
Position
10:22628488..22645145
AA seq 570 aa
MAAAAAEIVGSAAARMAAPAVRPAPPAAAAAAAPPQPRRAVAARSLRTSTSDRVAADLAL
GSNGSLSAQNIAENTADATSQVVSANSRRKTKIVCTIGPSTNTREMIWKLAETGMNVARM
NMSHGDHQSHQKVIDLVKEYNAKNTDGNVIAIMLDTKGPEVRSGDVPEPIMLEEGQEFNF
TIKRGVSTKDTVSVNYDDFINDVEVGDILLVDGGMMSLAVKSKTADTVKCEVVDGGELKS
RRHLNVRGKSATLPSITEKDWEDIKFGVENGVDFYAVSFVKDAKVIHELKDYLKSANADI
HVIPKIESADSIPNLQSIIAASDGAMVARGDLGAELPIEEVPLLQEEIVRTCRSMQKPVI
VATNMLESMIDHPTPTRAEVSDIAIAVREGSDAIMLSGETAHGKFPLKAVKVMHTVAQRT
ESSLYNPTTSPSLVAHPQALLNEEFSQSQLSKMFGSHATMMANTLCTPIIVFTRTGSMAV
LLSHYRPSSTIFAFTNEERVKQRLALYQGVVPIYMKFSDDAEETFSRAISSLLNAQFVKE
GDYVTLVQSGVKSIWREESTHHIQVRKVQG
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctgagatcgtggggtccgcggcggcgcgcatggcggcgccggca
gtgaggccggctccgcccgcggcggcggcggcggcggcgcccccgcagccgaggagggcc
gtggcggcgcgctccctcaggacctccacctccgacagggtggcggcggatctcgcgctc
gggagcaacggctccctctccgctcagaacattgctgagaataccgctgacgctacttcg
caagtggtctctgcgaattcccgtaggaagacaaagattgtttgcaccataggcccctca
accaacacacgcgagatgatatggaaacttgctgagactggaatgaacgtcgcacgcatg
aatatgtcccatggtgaccaccagtcgcaccagaaggtgattgatttggtgaaggagtac
aatgcgaagaatactgatggcaatgtcattgctattatgctggataccaagggtccagaa
gtgagaagtggggatgttccagaaccaatcatgctcgaggaaggtcaagagttcaatttt
actattaaaagaggggtgagcaccaaagacaccgtcagtgtgaattacgatgacttcata
aacgatgttgaagttggggacatactgttggtggatggaggaatgatgtcactcgctgtc
aagtctaaaacagctgatacggttaagtgtgaagtagttgatggtggggaactgaaatca
aggcgccacctaaatgtccgtggaaagagtgcgactttgccatctattacagagaaagat
tgggaggacataaagtttggtgttgaaaatggtgttgatttctatgccgtttcctttgtg
aaggatgcaaaagttattcatgaactgaaggactaccttaaaagtgctaatgcagatata
catgtcattccaaagattgaaagtgcagattcaataccaaacctccagtccattattgct
gcttcagatggggcgatggtggcaagaggggatcttggtgctgaacttccaattgaggaa
gttcctttgctgcaggaggagattgtcagaacatgccgaagcatgcagaaaccagttatt
gttgccacgaatatgttagagagcatgatagaccatcccactccaacaagagcagaagtt
tctgatatagcaattgcagttcgtgaaggttctgatgccatcatgctgtctggtgaaact
gcccatggaaagttcccactgaaggcagtcaaggtgatgcacacagtggcacagagaaca
gaatccagcctgtataacccaactacatctcctagtcttgttgcacatcctcaggctctg
ctcaacgaggaattttcgcaaagccaactaagcaaaatgtttggatctcatgctacaatg
atggcgaacaccctttgcaccccaattattgtgtttacacgaaccggctccatggcagtc
cttctcagccactaccggccctcgtctacaatttttgcatttacaaatgaggaacgagtg
aagcaacgtctggcactctaccagggtgtggttcccatttacatgaagttttctgatgat
gcagaggaaactttctctagagcaattagtagcttgctgaacgcccaattcgtgaaagaa
ggggactacgtgacccttgttcagagtggagtgaagtcgatctggagagaggagtctact
caccacattcaagtgaggaaagtccagggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349774
Entry
4349774           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase 1, cytosolic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4349774
   00620 Pyruvate metabolism
    4349774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349774
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349774
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4349774
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4349774
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349774
SSDB
Motif
Pfam: PK PK_C RibD_C
Other DBs
NCBI-GeneID: 4349774
NCBI-ProteinID: XP_015616831
UniProt: Q2RAK2 A0A188I036
LinkDB
Position
11:complement(2239298..2243469)
AA seq 527 aa
MHSTNLLLEEPIRMASILEPSKPSFFPAMTKIVGTLGPKSRAVDTISSCLKAGMSVARFD
FSWGDAEYHQETLENLKLAIKSTKKLCAVMLDTVGPELQVVNKSEAAISLEANGTVVLTP
DQGQEASSELLPINFSGLAKALKPGATIFVGQYLFTGSETTSVWLEVSEVKGDDVVCVIK
NSATLAGSLFTLHCSQIHIDLPTLSDEDKEVIRRWGAPNKIDFLSLSYTRHAEDVRQARE
FLSKLGDLSQTQIFAKIENVEGLNHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKSAL
HKCNMAGKPAVVTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
SIVGKICAEAEKVFNQDLYFKRTVKYVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVLSVVIPRLKTNQLRWSFTGAFEARQSLIVRGLFPMLADPRHPAES
TSATNESVLKVALDHGKASGVIKSHDRVVVCQKVGDSSVVKIIELDD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgcattcgacgaatctgctgctggaggagcccatcaggatggcatccatcctggagcca
tccaagccgagctttttcccggcgatgaccaagatcgtggggacgctgggtcccaagtcg
cgcgccgtcgacaccatctcctcctgcctcaaggccggcatgtcggttgccaggttcgat
ttctcgtggggagacgctgagtaccaccaggaaaccctcgaaaacctcaagctcgccatc
aagtccaccaagaagctctgtgctgtcatgctcgacactgtcggcccggagttgcaggtg
gtgaacaagagtgaggctgcaatctcccttgaagcgaatggcactgttgttctcacccct
gaccaggggcaggaggcctcctccgaattgctgcccatcaacttctccgggcttgctaag
gctctgaaaccaggtgctacaatttttgtggggcaatacttgttcactggcagtgagact
acttcagtttggttagaggtttctgaagttaaaggagatgatgtggtttgtgtgataaaa
aattcggctactctggctggttcactgttcaccctgcattgttctcagattcatatcgac
ttacctacactgtctgatgaggacaaggaggttatcagaagatggggagctccaaacaag
attgacttcctctctctgtcttatacaagacacgcggaagatgtgcgacaggcacgtgag
ttcctctcaaagttaggcgaccttagccaaactcagatttttgccaaaattgagaatgtt
gagggtttgaatcattttgatgaaatcctgcaagaggcggatggtatcattctgtcaaga
ggaaaccttggaattgatcttccacctgaaaaggtgtttttgtttcaaaagtctgctctg
cacaagtgcaacatggctggaaagcctgctgttgttactcgtgttgtggacagtatgact
gacaacctcaggcctactcgtgcggaggctactgatgtggcaaatgctgtacttgacggg
agtgatgccattctccttggtgctgagactctccgtggtctgtacccagttgagactatc
tcaattgtgggcaaaatttgcgctgaggcagagaaggtattcaaccaagatttatacttc
aagcggactgtgaaatatgttggggagcccatgacccacttggagtctatcgcttcttct
gcggtgcgagctgctatcaaagtgaaggcttctgtcattatttgcttcacatcatctgga
cgcgctgcaagactaattgccaagtacaggcccaccatgcctgttctatctgttgtcatt
cctcgtctgaaaacaaaccaactgaggtggagtttcactggcgcatttgaagcaagacaa
tcactcatagttagaggtctctttccgatgcttgctgatcctcgccatccagctgaatcg
accagcgctaccaatgagtcagttttgaaggttgctcttgaccatggcaaagcttccggt
gtgatcaagtcgcatgatcgcgttgttgtctgccagaaagtgggtgattcctcggttgtg
aagatcattgagctggacgattag

DBGET integrated database retrieval system