KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324263
Entry
4324263           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase, cytosolic isozyme
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4324263
   00620 Pyruvate metabolism
    4324263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324263
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324263
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4324263
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4324263
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4324263
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 4324263
NCBI-ProteinID: XP_015619741
UniProt: Q5NBQ0 A0A0N7KCR5
LinkDB
Position
1:complement(9694394..9699812)
AA seq 510 aa
MAVMEEQQEGAAGVMRRRPKTKIVCTLGPASRSVEMIGRLLRAGMCVARFNFSHGSHEYH
QETLDNLRAAMESTGILCAVMLDTKGPEIRTGFLKDGKPVQLKKGQEITVSTDYSIKGDD
NMISMSYKKLAVDLKPGSVILCADGTITLTVLHCDKEQGLVRCRCENTAMLGERKNVNLP
GVIVDLPTLTEKDKEDILKWGVPNKIDMIALSFVRKGSDLVEVRKVLGKHAKSIMLMSKV
ENQEGVANFDDILAQSDAFMVARGDLGMEIPIEKIFYAQKVMIFKCNIQGKPVVTATQML
ESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICLQAESCVDH
AAVFKSITASAPIPMSPLESLASSAVRTANSAKAALILVLTRGGTTARLVAKYRPSMPIL
SVVVPELKQTDSFDWTCSDEAPARHSLIVRGVIPMLSAATAKAFDNEATEEALGFAISNA
KAMGLCNSGESVVALHRIGTASVIKLLTAN
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggcggtgatggaggagcagcaggagggagccgcgggggtgatgcggcggaggcccaag
acgaagatcgtgtgcacgctggggccggcgtcgaggtcggtggagatgatcgggcggctg
ctccgcgccgggatgtgcgtcgcgcgcttcaacttctcccacggatcccacgagtaccac
caggagacgctcgacaacctccgcgccgccatggagagcaccggcatcctctgcgccgtc
atgctcgacaccaaggggccagagatccgaactggatttctgaaagatggaaaacccgta
cagttgaagaagggtcaagaaatcacagtttcaactgattatagcataaagggtgatgac
aacatgatatcaatgagctacaagaagctagcggtggatctgaagccaggcagtgtaata
ttatgtgctgatggcaccatcactcttactgtccttcactgtgataaagagcaaggcttg
gttcgctgccgttgtgagaacactgctatgcttggtgagaggaagaatgttaaccttcca
ggagttattgttgatctcccgacacttactgagaaggacaaggaggatattcttaaatgg
ggtgtcccaaacaagattgacatgattgctctgtcttttgttcgtaaaggctcagacctt
gtagaggtcaggaaggtgcttgggaagcatgcaaagtcaataatgctgatgtcaaaggtt
gagaatcaagagggagtggctaactttgatgatatcctggcacaatctgatgcttttatg
gttgcaaggggtgatttgggaatggaaattccgatagagaagatcttttatgcacagaag
gtgatgattttcaagtgcaatattcagggcaagccagttgtgactgcaacccagatgttg
gaatctatgatcaagtctccccgccctactagagcagaagcgactgatgttgccaatgca
gttcttgatggcactgactgtgtcatgctcagtggtgagacagctgctggggcttacccg
gaactggctgtacggaccatggccaagatctgcctgcaagcggagtcatgcgtcgaccat
gccgctgttttcaagtccattaccgcatcagctccaattcccatgagcccattggagagc
cttgcatcatcagctgtgcgtacagcgaactctgccaaggcggcgctcatcttggtcctg
actaggggaggaacaactgctaggctggtggccaagtacaggccatccatgccgattctg
tccgtcgtggttcctgagctgaaacagaccgactccttcgactggacctgcagcgacgaa
gctcctgcgcggcacagcctcatcgtcaggggagtgatcccgatgctgagtgcagccact
gccaaggccttcgacaacgaagccactgaagaagctctcgggttcgccatcagcaacgcc
aaggcgatggggctctgcaactccggtgagtccgtcgtcgccctccaccggatcggaact
gcatctgtcatcaagctcctgacagcgaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327173
Entry
4327173           CDS       T01015                                 
Name
(RefSeq) plastidial pyruvate kinase 2
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327173
   00620 Pyruvate metabolism
    4327173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327173
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327173
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4327173
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4327173
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4327173
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI Cellulase
Other DBs
NCBI-GeneID: 4327173
NCBI-ProteinID: XP_015622342
LinkDB
Position
1:complement(26888395..26895779)
AA seq 583 aa
MAQVVAAAGTAAAVAAVGRPLGGGGSGADALRPAARLSFAPRWCGGSAGAARARRESAVT
SVISRAPRLDAEVLPVSADDDADVKEEENFQHLKAIQQLATSANGVWSKPNVRRKTKIVC
TIGPSTNTKEMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKEYNAQTKDNVIAIMLDT
KGPEVRSGDLPQPIMLETGQEFTFTIKRGVGTETCVSVNYDDFVNDVEVGDMLLVDGGMM
SLLVKSKTEDSVKCEVIDGGELKSRRHLNVRGKSATLPSITDKDWDDIKFGVENQVDYYA
VSFVKDAQVVHELKDYLRSSNADIHVIVKIESADSIPNLHSIITASDGAMVARGDLGAEL
PIEEVPLLQEEIIRMCRSMGKAVIVATNMLESMIVHPTPTRAEVSDIAIAVREGSDGIML
SGETAHGKFPLKAVKVMHTVALRTEATMSGGETPANLGQVFKNHMSEMFAYHSTMMSNTL
GTSIVVFTRTGFMAILLSHYRPSGTIFAFTDQERVRQRLALYQGVCPVQMEFSDDAEKTF
GDALSYLLKHGMVKEGEEVALVQSGRQPIWRSQSTHNIQVRKV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcgcaggtggtggctgcggcagggacggcggcggcggtggcggcggtggggaggccg
ctgggtggcggcggatctggggccgacgcgctccgcccggcggcgaggctgtcgttcgcg
ccgcgctggtgcggtgggagcgcgggggcagcaagggcgcgccgcgagtccgccgtcacg
tccgtgattagccgcgccccgcgtctcgacgccgaggtgctgccggtgtcggccgacgac
gacgcggacgtgaaggaagaagaaaacttccagcatctcaaggccattcagcaacttgca
acatcagccaatggtgtgtggtctaaaccaaatgtgagacgcaagacaaagatcgtgtgc
accattggtccttcaactaacacaaaggagatgatatggaaacttgctgaggctggcatg
aatgtggctcggcttaatatgtcacatggagaccatgcatcacaccagaaagttattgac
ttagtaaaggaatataatgctcaaacaaaggataacgtgattgctattatgcttgacacg
aagggaccagaagttaggagtggagatttgcctcaaccaataatgttggaaactggccag
gagttcactttcacaattaagagaggagttgggactgagacatgtgttagcgttaactat
gatgactttgttaatgatgtagaagtgggtgacatgctcctcgtagatggtggaatgatg
tcgttgttggtcaagtccaaaactgaagattcggtaaaatgtgaagttattgatggaggt
gaactgaaatccaggcgtcacctgaatgttcgtggaaagagcgcaaccttgccatcaata
actgacaaggattgggatgatattaagtttggtgtggagaatcaagttgactactatgcc
gtttcttttgtcaaagatgctcaagttgtgcatgaattgaaggattatctcagaagctcc
aatgccgatatacatgtaattgtaaagattgaaagtgcagattccattccaaacctacac
tcaatcatcacagcatcggatggggctatggttgccagaggtgacttgggagctgaactc
cctattgaggaggtaccgctgctgcaggaagaaattattagaatgtgcaggagcatggga
aaagctgttattgttgccactaatatgctagaaagtatgattgttcatccaactccaacc
cgagcagaagtttcagacattgctatagctgttcgagaaggttctgatggcattatgctt
tctggggaaactgcacacggaaagtttcctttgaaagctgttaaggtcatgcatactgtt
gccctgagaactgaagccactatgtctggtggggaaacaccggctaaccttggtcaggtg
ttcaagaatcacatgagtgaaatgtttgcataccattcaacaatgatgtccaacactctt
ggaacatcaattgtggttttcaccaggacaggatttatggctatcctacttagtcattac
cgcccttctggcaccatttttgcctttacggaccaggagagagttagacaacgattggct
ttgtaccaaggtgtatgtccagtccagatggaattttctgatgatgctgagaagacattt
ggtgacgctttgtcatacttgctgaaacatggtatggtgaaggaaggcgaggaggttgca
cttgttcaaagtggcaggcaacctatctggcggtcgcagtccacccataatattcaggtc
aggaaggtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333694
Entry
4333694           CDS       T01015                                 
Name
(RefSeq) plastidial pyruvate kinase 1, chloroplastic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4333694
   00620 Pyruvate metabolism
    4333694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333694
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4333694
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4333694
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4333694
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4333694
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI DnaB_C
Other DBs
NCBI-GeneID: 4333694
NCBI-ProteinID: XP_015633267
UniProt: Q0DPQ1 Q84R73
LinkDB
Position
3:complement(26526607..26530732)
AA seq 548 aa
MATSAAAAASTLPYLVAAASSSAAARRRGAHRIRASSAAAEVEGAMDVVSEAELREKGFM
GLRKTKLVCTVGPACVGALPALARGGMGVARVNLCHGGRGWHRAVMREVRRLNEEEGFCV
SLMVDTEGSQLLVADHGGAASVKAEDGSEWLFTSKRTDESHPFTMHVNFDKFSEDILVGD
ELVIDGGMATFEVIEKVGNDLRCKCTDPGLLLPRAKLSFWRNGKLVERNFGLPTLSAKDW
ADIEFGIAEGVDCIALSFVKDANDIKYLKTYLSRKSLEHIKIFAKVESLESLKNLKDIIE
ASDGVMVARGDLGVQIPLEQIPAIQEAIVDLCRRLNKPVIVASQLLESMVEYPTPTRAEV
ADVSEAVRQYADAVMLSAESAIGAYPQKALAVLRAASERMESWSREENMQKLLPQHQLAI
ALPDRISEQICTSAAEMANNLAVDAIFVYTKYGHMASLLSRNRPNPPIFAFTDNANSRKS
MNLYWGVIPLQLPLSNNMEDNFNQTIKLMKSKGSVKSGDTVLVVADSDLNRPRAATSVFQ
SIQVRIVD
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcaacctccgccgccgccgccgcgagcaccttgccttacctcgtcgccgccgcctcc
tcctccgcggcggcgcgccgccgcggggcccaccggatccgggcgtcgtcggcggcggcg
gaggtggagggggcgatggacgtggtgtcggaggcggagctgcgggagaaggggttcatg
gggctccggaagacgaagctggtgtgcacggtggggcccgcgtgcgtgggggctttgccg
gcgctggcgcgcggcgggatgggcgtggcgcgggtcaacctgtgccacgggggccgcggc
tggcaccgcgccgtgatgcgcgaggtgcggaggctcaacgaggaggaaggcttctgcgtc
tccctcatggtcgacaccgaggggtcccagctcctcgtcgccgaccacggcggcgccgcc
tccgtcaaggccgaggatggctctgaatggctatttacaagtaaaagaaccgatgaatct
catccattcacaatgcatgttaactttgataagttttctgaagacattctagttggtgat
gagcttgtaattgatggaggaatggcaacatttgaagttattgagaaggtcggaaatgat
ttgcgctgtaagtgcacagacccaggtttgcttcttcctcgagccaaactgtcattctgg
aggaatggaaaattagttgaaaggaactttgggcttcctacattgtcagcaaaggattgg
gctgacattgaatttgggatagctgaaggagttgattgcatcgctctttcatttgtaaaa
gatgctaatgacatcaagtatctcaagacttacctctccagaaaatcattagaacacatc
aaaatattcgcgaaggttgagagtcttgaatcactcaagaaccttaaagacatcatagag
gcatctgatggagttatggtagcacgtggtgatcttggagttcagattcctttagaacaa
atcccagccatccaagaggcaattgttgatctttgtcgacggttgaacaagccagtgata
gttgcctctcagcttcttgaatcaatggttgagtatccaacaccaactcgtgcagaggta
gcagacgtttctgaagcagtacggcaatatgctgatgccgtaatgttatcggcagagtca
gctataggtgcatatccccagaaagctctagcagtcctccgtgctgctagtgagaggatg
gaatcatggagccgtgaggaaaacatgcagaaacttcttccacaacatcagcttgcaata
gctttgcctgataggatctcagagcaaatttgcaccagtgctgcagaaatggcaaacaac
cttgcggtggatgccatctttgtttacacaaagtatggtcacatggcgtcgcttctttcg
cgcaaccggcccaaccctcccatttttgctttcactgataatgccaactcaagaaagagc
atgaacctctactggggagtaattccacttcagctaccactgtcaaataacatggaagat
aacttcaatcaaaccatcaagcttatgaagtcgaagggttcagtgaaatctggagacaca
gtcttggtcgtcgccgactctgatctgaaccgaccccgtgctgctacctcagttttccaa
tccattcaagttcgaatagtggactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337406
Entry
4337406           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase, cytosolic isozyme
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337406
   00620 Pyruvate metabolism
    4337406
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337406
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337406
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4337406
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4337406
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4337406
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 4337406
NCBI-ProteinID: XP_015635772
UniProt: Q7XKB5 Q0J908
LinkDB
Position
4:complement(34605338..34609122)
AA seq 511 aa
MANIDMGKILAGLENDDARVPKTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHE
YHQETLDNLRQAMHNTGVLCAVMLDTKGPEIRTGFLKDGKPIKLTKGQELTVTTDYEIKG
DENMITMSYKKLPVDVKPGNVILCADGTISLTVLSCDPKAGTVRCRCENTAMLGERKNCN
LPGIVVDLPTLTEKDKEDILGWGVPNDIDMIALSFVRKGSDLVTVRQLLGQHAKRIKLMS
KVENQEGVVNFDEILRETDAFMVARGDLGMEIPVEKIFLAQKMMIYKCNLAGKPVVTATQ
MLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEVAVKIMARICVEAESSL
DNEAVFKEMIRSAPLPMSPLESLASSAVRTANKAKAALIVVLTRGGTTAKLVAKYRPRVP
ILSVVVPVLTTDSFDWTISSEGPARHSLIYRGLVPLLAEGSAKATDSESTEVILDAALKS
AVQKQLCKPGDAVVALHRIGVASVIKICIVK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgaacatcgacatggggaagatcctggcggggctggagaacgacgacgcgcgggtg
cccaagaccaagctggtctgcacgctcggcccggcctcccgctccgtccccatgctcgag
aagctgctccgcgccgggatgaacgtcgcgcgcttcaacttctcccacggcacccacgag
taccaccaggagaccctcgacaacctccgccaggccatgcacaacaccggcgtcctctgc
gccgtcatgctcgataccaagggtcctgagattcgtactggatttttgaaggatggcaag
ccaatcaagctaacaaagggtcaagaactcactgttaccaccgattatgagatcaagggt
gatgagaacatgattaccatgagttacaagaaactgccagttgatgtgaagcctggaaat
gtcattctctgcgccgatggtacaatctctttgactgttttgtcctgtgatccaaaggct
ggaactgtgaggtgtaggtgtgagaacacagcaatgcttggcgagagaaagaattgcaat
ctgccaggaattgttgtggaccttcctacactgactgagaaggataaagaagacattttg
ggatggggtgtgccaaatgacatagacatgattgctctgtcgtttgtccgtaaaggatca
gatttggttaccgtcagacaacttcttggacagcatgcaaagcgcatcaagctgatgtca
aaggttgaaaaccaagagggtgttgtaaacttcgatgagatcttgagggaaacggatgca
tttatggttgctagaggtgatcttggaatggagattccagttgagaagatattccttgca
cagaagatgatgatttacaagtgcaaccttgctggaaagcctgttgtgactgctactcag
atgcttgagtcgatgatcaaatcaccacgtccaactcgtgctgaggcaactgacgttgca
aatgcagttcttgatggaactgactgcgtcatgcttagtggagagagtgctgctggagca
taccctgaagtagctgtgaagatcatggcacgtatatgtgttgaggcagagtcttccctt
gacaacgaagctgtcttcaaggagatgatcaggtctgcgccccttccgatgagcccattg
gagtctctcgcatcctctgctgtacgcacagccaacaaggccaaggcagccctgattgtt
gtcttgactcgtggtggtaccacggcaaagctggttgccaagtatcgtcccagggttcca
atcctctctgtggttgtccccgtgttgacaaccgattcattcgactggacaatcagctcg
gagggcccagcaaggcacagcctaatctacagaggtcttgttcctctcctggctgagggt
tctgccaaagccaccgattcggagtcgacagaggtcatccttgatgctgctctcaagtca
gctgtacagaagcagttgtgcaagcctggtgatgctgttgttgctctgcaccgtattggc
gtcgcatccgtgatcaagatctgcatcgtgaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342564
Entry
4342564           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase isozyme A, chloroplastic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4342564
   00620 Pyruvate metabolism
    4342564
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342564
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342564
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4342564
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4342564
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4342564
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI DnaB_C
Other DBs
NCBI-GeneID: 4342564
NCBI-ProteinID: XP_015647744
UniProt: A3BH68
LinkDB
Position
7:4266867..4271499
AA seq 578 aa
MAATAAAAHTLLHLAAPRKPSAGPPLPPATLRLPSRRLARLTASCSSGSGNNSAADFPNP
NGILVAPPSAAAVAAASSHIDVDVATEADLRENGFRSTRRTKLVCTVGPATCGADELEAL
AVGGMNVARVNMCHGDREWHRGVIRAVRRLNEEKGFAVAVMMDTEGSEIHMGDLGGAAAA
KAEDGEIWTFSVRSFEAPPPERTIHVNYEGFAEDVRVGDELLVDGGMARFEVVEKLGPDV
KCRCTDPGLLLPRANLTFWRDGSIVRERNAMLPTISSKDWLDIDFGISEGVDFIAVSFVK
SAEVINHLKSYIAARSRGSDIAVIAKIESIDSLKNLEEIIRASDGAMVARGDMGAQIPLE
QVPSVQQKIVKLCRQLNKPVIVASQLLESMIEYPTPTRAEVADVSEAVRQRADALMLSGE
SAMGRYPEKALSVLRSVSLRIEKWWREEKRHEELELKDVSSSFSDKISEEICISAAKMAN
KLEVDAVFVYTNTGHMASLLSRCRPDCPIFAFTTSTSVRRRLNLQWGLIPFRLSFSDDME
SNLNRTFSLLKARGMIQSGDLVIALSDMLQSIQVMNVP
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggccgccaccgccgccgcggcccacaccctcctccacctcgcggccccgaggaagccc
tccgcggggcccccactcccgcccgccaccctccgcctccccagccgccgcctcgcccgt
ctcacggccagctgcagcagcggctccgggaacaacagcgccgccgacttccccaacccc
aacgggatcctcgtcgcgcccccgtccgccgcggcggtggcggcggcgtcgtcgcatatc
gatgttgacgtggcgacggaggccgacctgagggagaacgggttccggagcacgcggcgc
accaagctcgtctgcaccgtggggcccgccacctgcggcgccgacgagctggaggcgctc
gccgtcggcgggatgaacgtcgcgcgcgtcaacatgtgccacggggaccgggagtggcac
cggggcgtcatccgcgcggtgcggaggctcaacgaggagaaggggttcgccgtcgccgtc
atgatggacaccgaggggagcgagatccacatgggggacctcggcggcgccgccgccgcc
aaggcggaggatggagaaatatggacatttagcgtaagatcctttgaggcacctccccca
gaacgaactattcatgtgaactacgaaggcttcgctgaagatgtgagagttggtgatgag
cttcttgttgatggtggcatggctcggtttgaggtggttgagaaattaggaccagatgtc
aagtgccgttgcacagatcctggtttgttgctgccacgtgccaatcttacattttggcgg
gatggtagtattgtccgtgagaggaacgctatgctacctaccatttcatcaaaggattgg
cttgacatagactttggaatttctgaaggcgtagattttattgcagtttcgtttgtcaaa
tctgcagaagtaattaaccatctgaaaagctatatagctgcaaggagccgtggcagcgat
atagcagtcattgccaagatcgagagcattgactctttgaagaacttggaggagataatc
cgtgcttcagatggtgccatggtagcccgaggggatatgggtgcacaaattcccttggag
caagtcccctcagtacaacaaaagatagttaaactgtgcaggcagctcaacaagccagtc
attgttgcgtcgcagcttcttgaatcgatgattgagtatcctacgcccaccagggccgag
gttgctgatgtttctgaagcagttcgtcagcgtgcagatgcgcttatgctttcaggtgag
tcagcaatggggagatatccagagaaagctcttagtgtcctccggagtgttagcctaagg
attgagaagtggtggagagaggagaagcgccatgaggaactggaacttaaagatgtttca
tcttccttctctgacaaaatatcagaagaaatctgcatttcggccgctaaaatggccaac
aaattggaggtagatgccgttttcgtctacacaaacactggccacatggcctcactgctc
tcgcggtgccgtcctgactgcccgatcttcgccttcacgacctcgacatctgtgaggaga
cgattgaacctccaatggggcctcatccccttccgcctcagcttctcggacgacatggag
agcaacctgaaccgtaccttctcgctgctcaaggccaggggcatgatccagtccggcgac
cttgtcatcgcgctctccgacatgctgcagtccatccaggtcatgaacgtaccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349454
Entry
4349454           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase isozyme G, chloroplastic isoform X1
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4349454
   00620 Pyruvate metabolism
    4349454
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349454
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349454
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4349454
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4349454
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349454
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI TTC5_OB OSK Cellulase IMPDH
Other DBs
NCBI-GeneID: 4349454
NCBI-ProteinID: XP_015614430
UniProt: Q8S7N6 Q0IVH4
LinkDB
Position
10:22628488..22645145
AA seq 570 aa
MAAAAAEIVGSAAARMAAPAVRPAPPAAAAAAAPPQPRRAVAARSLRTSTSDRVAADLAL
GSNGSLSAQNIAENTADATSQVVSANSRRKTKIVCTIGPSTNTREMIWKLAETGMNVARM
NMSHGDHQSHQKVIDLVKEYNAKNTDGNVIAIMLDTKGPEVRSGDVPEPIMLEEGQEFNF
TIKRGVSTKDTVSVNYDDFINDVEVGDILLVDGGMMSLAVKSKTADTVKCEVVDGGELKS
RRHLNVRGKSATLPSITEKDWEDIKFGVENGVDFYAVSFVKDAKVIHELKDYLKSANADI
HVIPKIESADSIPNLQSIIAASDGAMVARGDLGAELPIEEVPLLQEEIVRTCRSMQKPVI
VATNMLESMIDHPTPTRAEVSDIAIAVREGSDAIMLSGETAHGKFPLKAVKVMHTVAQRT
ESSLYNPTTSPSLVAHPQALLNEEFSQSQLSKMFGSHATMMANTLCTPIIVFTRTGSMAV
LLSHYRPSSTIFAFTNEERVKQRLALYQGVVPIYMKFSDDAEETFSRAISSLLNAQFVKE
GDYVTLVQSGVKSIWREESTHHIQVRKVQG
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctgagatcgtggggtccgcggcggcgcgcatggcggcgccggca
gtgaggccggctccgcccgcggcggcggcggcggcggcgcccccgcagccgaggagggcc
gtggcggcgcgctccctcaggacctccacctccgacagggtggcggcggatctcgcgctc
gggagcaacggctccctctccgctcagaacattgctgagaataccgctgacgctacttcg
caagtggtctctgcgaattcccgtaggaagacaaagattgtttgcaccataggcccctca
accaacacacgcgagatgatatggaaacttgctgagactggaatgaacgtcgcacgcatg
aatatgtcccatggtgaccaccagtcgcaccagaaggtgattgatttggtgaaggagtac
aatgcgaagaatactgatggcaatgtcattgctattatgctggataccaagggtccagaa
gtgagaagtggggatgttccagaaccaatcatgctcgaggaaggtcaagagttcaatttt
actattaaaagaggggtgagcaccaaagacaccgtcagtgtgaattacgatgacttcata
aacgatgttgaagttggggacatactgttggtggatggaggaatgatgtcactcgctgtc
aagtctaaaacagctgatacggttaagtgtgaagtagttgatggtggggaactgaaatca
aggcgccacctaaatgtccgtggaaagagtgcgactttgccatctattacagagaaagat
tgggaggacataaagtttggtgttgaaaatggtgttgatttctatgccgtttcctttgtg
aaggatgcaaaagttattcatgaactgaaggactaccttaaaagtgctaatgcagatata
catgtcattccaaagattgaaagtgcagattcaataccaaacctccagtccattattgct
gcttcagatggggcgatggtggcaagaggggatcttggtgctgaacttccaattgaggaa
gttcctttgctgcaggaggagattgtcagaacatgccgaagcatgcagaaaccagttatt
gttgccacgaatatgttagagagcatgatagaccatcccactccaacaagagcagaagtt
tctgatatagcaattgcagttcgtgaaggttctgatgccatcatgctgtctggtgaaact
gcccatggaaagttcccactgaaggcagtcaaggtgatgcacacagtggcacagagaaca
gaatccagcctgtataacccaactacatctcctagtcttgttgcacatcctcaggctctg
ctcaacgaggaattttcgcaaagccaactaagcaaaatgtttggatctcatgctacaatg
atggcgaacaccctttgcaccccaattattgtgtttacacgaaccggctccatggcagtc
cttctcagccactaccggccctcgtctacaatttttgcatttacaaatgaggaacgagtg
aagcaacgtctggcactctaccagggtgtggttcccatttacatgaagttttctgatgat
gcagaggaaactttctctagagcaattagtagcttgctgaacgcccaattcgtgaaagaa
ggggactacgtgacccttgttcagagtggagtgaagtcgatctggagagaggagtctact
caccacattcaagtgaggaaagtccagggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349774
Entry
4349774           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase 1, cytosolic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4349774
   00620 Pyruvate metabolism
    4349774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349774
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349774
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4349774
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4349774
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349774
SSDB
Motif
Pfam: PK PK_C RibD_C
Other DBs
NCBI-GeneID: 4349774
NCBI-ProteinID: XP_015616831
UniProt: Q2RAK2 A0A188I036
LinkDB
Position
11:complement(2239298..2243469)
AA seq 527 aa
MHSTNLLLEEPIRMASILEPSKPSFFPAMTKIVGTLGPKSRAVDTISSCLKAGMSVARFD
FSWGDAEYHQETLENLKLAIKSTKKLCAVMLDTVGPELQVVNKSEAAISLEANGTVVLTP
DQGQEASSELLPINFSGLAKALKPGATIFVGQYLFTGSETTSVWLEVSEVKGDDVVCVIK
NSATLAGSLFTLHCSQIHIDLPTLSDEDKEVIRRWGAPNKIDFLSLSYTRHAEDVRQARE
FLSKLGDLSQTQIFAKIENVEGLNHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKSAL
HKCNMAGKPAVVTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
SIVGKICAEAEKVFNQDLYFKRTVKYVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVLSVVIPRLKTNQLRWSFTGAFEARQSLIVRGLFPMLADPRHPAES
TSATNESVLKVALDHGKASGVIKSHDRVVVCQKVGDSSVVKIIELDD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgcattcgacgaatctgctgctggaggagcccatcaggatggcatccatcctggagcca
tccaagccgagctttttcccggcgatgaccaagatcgtggggacgctgggtcccaagtcg
cgcgccgtcgacaccatctcctcctgcctcaaggccggcatgtcggttgccaggttcgat
ttctcgtggggagacgctgagtaccaccaggaaaccctcgaaaacctcaagctcgccatc
aagtccaccaagaagctctgtgctgtcatgctcgacactgtcggcccggagttgcaggtg
gtgaacaagagtgaggctgcaatctcccttgaagcgaatggcactgttgttctcacccct
gaccaggggcaggaggcctcctccgaattgctgcccatcaacttctccgggcttgctaag
gctctgaaaccaggtgctacaatttttgtggggcaatacttgttcactggcagtgagact
acttcagtttggttagaggtttctgaagttaaaggagatgatgtggtttgtgtgataaaa
aattcggctactctggctggttcactgttcaccctgcattgttctcagattcatatcgac
ttacctacactgtctgatgaggacaaggaggttatcagaagatggggagctccaaacaag
attgacttcctctctctgtcttatacaagacacgcggaagatgtgcgacaggcacgtgag
ttcctctcaaagttaggcgaccttagccaaactcagatttttgccaaaattgagaatgtt
gagggtttgaatcattttgatgaaatcctgcaagaggcggatggtatcattctgtcaaga
ggaaaccttggaattgatcttccacctgaaaaggtgtttttgtttcaaaagtctgctctg
cacaagtgcaacatggctggaaagcctgctgttgttactcgtgttgtggacagtatgact
gacaacctcaggcctactcgtgcggaggctactgatgtggcaaatgctgtacttgacggg
agtgatgccattctccttggtgctgagactctccgtggtctgtacccagttgagactatc
tcaattgtgggcaaaatttgcgctgaggcagagaaggtattcaaccaagatttatacttc
aagcggactgtgaaatatgttggggagcccatgacccacttggagtctatcgcttcttct
gcggtgcgagctgctatcaaagtgaaggcttctgtcattatttgcttcacatcatctgga
cgcgctgcaagactaattgccaagtacaggcccaccatgcctgttctatctgttgtcatt
cctcgtctgaaaacaaaccaactgaggtggagtttcactggcgcatttgaagcaagacaa
tcactcatagttagaggtctctttccgatgcttgctgatcctcgccatccagctgaatcg
accagcgctaccaatgagtcagttttgaaggttgctcttgaccatggcaaagcttccggt
gtgatcaagtcgcatgatcgcgttgttgtctgccagaaagtgggtgattcctcggttgtg
aagatcattgagctggacgattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350078
Entry
4350078           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase 1, cytosolic-like
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4350078
   00620 Pyruvate metabolism
    4350078
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4350078
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4350078
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4350078
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4350078
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4350078
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI
Other DBs
NCBI-GeneID: 4350078
NCBI-ProteinID: XP_015617853
UniProt: A0A8J8XAK3 Q2R8U5
LinkDB
Position
11:6059303..6065401
AA seq 527 aa
MQGANMLLDEPVRLTSVLTPVKPKVFPSLTKIVGTLGPNSHSVEVIQECLTAGMAVARFD
FSWMDASYHQETLNNLRKAAQNVNKLCPVMLDTLGPEIQVHNSTGGPIELKAGNHVTITP
DLSKAPSSEILPIKFGGLAKAVKKGDTLFIGQYLFTGSETTSSWLEVVETSGENVECLVT
NTATLAGPMFTLHVSKAHVSLPTLSDYDKEVISTWGLHNSVDIISLSHTRSAEDVRELRS
FLQSHGLQDTQIYAKVENTEGLDHFDEILQEADGVIISRGDLGIDLPPEDVFISQKTAIK
KCNLAGKPVIITRVVDSMIDNLRPTRAEATDVANAVLDGTDGILLGAETHRGPYPVDAVS
TVGRICAEAESVYNQLVHFKKLVKHVGDPMPHEESVASSAVRTAMKVKAAAIVVFTFSGR
AARLVAKYKPPMPVLAVVFPREGSDPTKWRSYGTTQARQCFAARGVYPLMASTEEAETGG
LTREEYGIKLAQNYGRSVGMLKPYDRLIIFQKIGDSSVVKIIECDSS
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgcagggcgccaacatgctcctggacgagcccgtccgcctcacctccgtcctcaccccc
gtcaagcccaaagtattcccatcactcaccaagattgttgggacccttgggcccaactca
cactccgtcgaggttattcaagaatgcctcactgctgggatggcagtcgcacggtttgat
ttctcatggatggatgcttcatatcatcaggagacccttaacaatctgaggaaagctgca
caaaatgtcaataagctgtgccctgtaatgctggatacactgggtccagaaattcaggtt
cacaattcaactggtggaccaattgagttgaaagctggaaatcatgtcaccataacacca
gatctttctaaagctccctcttctgaaatcttgccaattaagtttggtggtcttgcaaaa
gctgtcaagaagggtgatactctttttattggtcaatatctcttcacaggaagtgaaaca
acatcttcgtggcttgaggttgtggaaacttctggagaaaatgttgaatgtcttgtgacc
aatacagctacacttgcaggccccatgttcactttgcatgtttcaaaagcccatgtcagt
ttaccaactttgagtgattatgataaagaggtcatttcaacttggggattacataacagt
gttgatattatatcactttcccatacccgctctgccgaggatgtcagggagcttagatct
tttcttcaatctcatggccttcaggacacacagatatatgccaaggttgaaaatactgag
ggtttggatcattttgatgaaattctccaagaagctgatggcgtcattatttcacgggga
gacctgggaattgaccttccaccagaagatgtgttcatatcccaaaaaacagctattaag
aaatgcaatcttgctggcaaacctgtgatcatcactagagttgtggacagcatgattgac
aatctacgcccaacacgtgcagaggccactgatgttgcaaatgctgtcctagatggaacg
gatggcattttgcttggtgcggagactcatcgaggcccttatccagttgatgcagtgagt
actgttgggagaatatgtgcagaagctgagtctgtgtataaccagttggttcacttcaag
aaattagtgaagcatgtaggtgatccaatgccccatgaagaatctgtggcatcttcagcg
gttcgcactgcaatgaaggtaaaagctgctgcaatcgttgtgttcactttctcaggaaga
gctgccaggttagttgccaagtacaagccaccaatgccagtgttggccgttgtcttccca
cgtgagggctctgatccaacaaagtggcgttcttacggcacaactcaggcaaggcaatgt
tttgctgcaagaggtgtctaccctttgatggcgagtactgaggaggctgaaactggtggg
ctcaccagggaagagtacgggataaaacttgcacagaactatggtcgctcggttggtatg
ctaaagccctatgacaggttgatcattttccagaagatcggcgattcatctgttgtcaag
atcatcgagtgtgacagttcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351493
Entry
4351493           CDS       T01015                                 
Name
(RefSeq) pyruvate kinase 2, cytosolic
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4351493
   00620 Pyruvate metabolism
    4351493
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351493
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351493
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     4351493
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4351493
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4351493
SSDB
Motif
Pfam: PK PK_C
Other DBs
NCBI-GeneID: 4351493
NCBI-ProteinID: XP_015620584
UniProt: Q2QXR8
LinkDB
Position
12:complement(2245435..2249832)
AA seq 527 aa
MHSTNLLLEEPIRMASILEPSKPSFFPAMTKIVGTLGPKSRSVDTISSCLKAGMSVARFD
FSWGDAEYHQETLENLKVAIKSTKKLCAVMLDTVGPELQVVNKSEASISLEENGTVILTP
DQGQEASSQVLPINFAGLAKAVKPGDTIFVGQYLFTGSETTSVWLEVSQIKGDDVVCVIK
NTATLAGSLFTLHCSQIHIDLPTLSDEDKEVIRKWGAPNKIDFLSLSYTRHVEDVRQARE
FLSKLGDLSQTQIFAKIENVEGLNNFDEILQEADGIILSRGNLGIDLPPEKVFLFQKSAL
HKCNMAGKPAVVTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
SIVGKICAEAEKVFNQDLYFKRTVKHVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVLSVVIPRLKTNQLRWSFTGAFEARQSLIVRGLFPMLADPRHPAES
TNATNESVLKVALDHGKVSGVIKSHDRVVVCQKVGDSSVVKIIELDD
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgcattcgacgaatctgctgctggaggagcccatcaggatggcatccatcctggagcca
tccaagcccagcttcttcccggcgatgaccaagatcgtggggacgctggggccaaagtcg
cgctccgtcgacaccatctcctcctgcctcaaggccggcatgtcggtggcccgatttgat
ttctcgtggggagacgccgagtaccaccaggaaacccttgagaacctcaaggtcgccatc
aagtccaccaagaagctctgcgcggtcatgcttgacacggtcggcccagagttgcaggtg
gtgaacaagagcgaagcctccatctccctcgaggagaacggcactgttattctcacccct
gaccaggggcaggaggcctcctcacaagtgctgccaattaacttcgctgggcttgctaag
gctgtgaagccaggtgacacaatatttgttgggcaatacttgttcacaggcagtgagact
acttcagtttggttagaggtttctcaaattaaaggagatgatgtggtctgtgtgataaaa
aacacagcaactctggctgggtcgctcttcacattgcattgctcgcagattcacatcgac
ttacctaccctatctgatgaggacaaggaggttatcagaaaatggggtgccccaaacaag
attgacttcctctctctttcttatacaagacatgtagaagatgtgcgacaggcacgtgaa
ttcctctcaaagttaggtgaccttagccagacccagatttttgcaaaaatcgagaatgtg
gaggggttgaataattttgatgaaatcctccaagaagctgatggtatcatcctgtcaaga
ggaaaccttggaattgatcttccacctgaaaaggtgtttttatttcaaaagtctgctctg
cacaagtgcaacatggctggaaagcctgctgttgttactcgtgttgtagacagtatgact
gacaacctcaggcctactcgtgcagaggctacggatgtggcaaatgcagtgcttgacggg
agtgatgccattctccttggtgctgagactctgcgtggtttatacccagttgagactatt
tcaatagtgggtaaaatttgtgctgaggctgagaaggtcttcaaccaagatttatacttc
aagagaactgtgaaacatgtgggggagcccatgacccacttggagtctattgcttcctct
gcggtgcgagctgctattaaagtgaaggcgtctgtcataatttgcttcacatcatctgga
cgtgctgcaaggctaattgccaagtataggccaaccatgcctgttctatctgttgtcatt
cctcgtctaaaaacaaatcaactgaggtggagtttcactggcgcatttgaagcaagacaa
tcgctcatagttagaggcctctttccgatgcttgctgatccgaggcatccagctgaatca
accaacgctacaaatgaatccgttttgaaggttgctcttgaccacggtaaagtttctggt
gtgataaagtcgcatgatcgcgttgttgtctgccagaaggtgggagattcctcggttgtg
aagatcattgagctggacgattag

DBGET integrated database retrieval system