KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324282
Entry
4324282           CDS       T01015                                 
Name
(RefSeq) histidinol dehydrogenase, chloroplastic
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4324282
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     4324282
SSDB
Motif
Pfam: Histidinol_dh
Other DBs
NCBI-GeneID: 4324282
NCBI-ProteinID: XP_015618412
UniProt: Q5NAY4
LinkDB
Position
1:7348577..7352132
AA seq 473 aa
MSLRPGRAHPLAASPLHTPLPARPRPQLRLSTSTSCAAMKSYRLSELSDAEVGGLKARPR
IDFSSIFGTVNPIVEDVRMRGDAAVKDYTVKFDKVALDDVVVRVSDLPDVELDPAVKEAF
DVAYDNIYAFHVSQKLPEKTVENMKGVRCKRITRCIGSVGLYVPGGTAVLPSTALMLAVP
AQIAGCKTVVLATPPSRDGSICKEVLYCAKKAGVTHVLKAGGAQAISAMAWGTVSCPKVE
KIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKYANPVHVAADLLSQAEHGP
DSQVVLVVAGDGVDLGAIEAEVSKQCSALPRGEFASKALGHSFTVFAKDMVEAISFSNMY
APEHLIINVKDAEQWEDLVENAGSVFLGQWTPESVGDYASGTNHVLPTYGYARMYSGVSL
NSFLKYITVQSLSEEGLRSLGPHVAKMAEVEGLEAHRRAVTLRLQDIEATVTV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgagcttgcggccgggcagggcgcaccccctcgccgcgtctcccctccacaccccgctc
cctgctaggcctaggccccagctgaggctgagcacctccaccagctgcgccgccatgaag
tcgtacaggctgtcggagctcagcgacgccgaggtcggcggcctcaaggcgcgcccccgc
atcgacttctcctccattttcggcacggtcaatccgattgttgaagacgtgcgcatgcga
ggcgatgctgcggtcaaggattatacagtgaagttcgacaaggttgcactcgatgatgtg
gttgtgcgtgttagcgatcttccggatgtggagcttgatccagctgtgaaggaagccttt
gatgtggcatatgacaacatttatgccttccacgtttcgcaaaagttgcctgaaaagact
gttgagaatatgaaaggtgtaagatgtaaaagaataacaagatgcattggttctgttggc
ctttatgtcccaggtggcactgcagtattgccttccactgcattgatgcttgctgtgcct
gcacagattgctggttgcaaaactgttgttcttgccacaccccctagtcgtgatggtagc
atatgtaaggaggttctttactgtgctaaaaaagctggtgtgacacatgtattgaaagct
ggaggagctcaggccatttcagccatggcatggggaacagtctcatgcccaaaggttgaa
aaaatatttggacctggaaatcagtatgtcacggctgcaaaaatgattcttcagaacagt
gaagccatggtttctatagacatgcctgctggcccttcagaagtattagtgatagcggat
aaatatgcaaacccagttcatgttgctgctgatttgttatctcaggcggaacatggccca
gacagtcaggttgttctagttgttgcgggagacggtgttgatttgggtgctattgaggca
gaagttagcaagcagtgctctgctcttcctaggggagaatttgcttcgaaagctcttggc
cacagtttcactgtttttgcgaaagacatggttgaggcaatttcattctccaatatgtat
gcccctgagcatttgatcatcaatgtaaaggatgctgaacagtgggaggatcttgtcgag
aatgcagggtcggtcttcttgggacaatggaccccggagagcgtgggcgactatgcaagc
ggcacaaaccatgtccttccaacctatggttacgcaaggatgtatagcggcgtgtcactg
aactcattcctcaagtacatcactgtccagtccttgtcagaggaagggttgagaagtctg
ggtccgcatgtggcaaagatggctgaagtcgaaggactagaggctcacagaagagctgtt
accctcagacttcaggacatcgaagccactgtaaccgtgtag

DBGET integrated database retrieval system