KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324310
Entry
4324310           CDS       T01015                                 
Name
(RefSeq) 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
  KO
K06127  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.201]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4324310
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     4324310
SSDB
Motif
Pfam: Ubie_methyltran Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 Methyltransf_23 Methyltransf_8 DUF896
Other DBs
NCBI-GeneID: 4324310
NCBI-ProteinID: XP_015641142
UniProt: Q5JNC0
LinkDB
Position
1:complement(43159503..43162844)
AA seq 294 aa
MALRSAAGRLASSSRRRLLSPPTSIHTAFLHSHATSFGYKQVAEEDKSKLVGNVFSSVAS
SYDLMNDLMSVGLHRLWKDRLISKLNPFPGMKHLDVAGGTGDVAFRALERINSVSHRAMQ
GTLTDIEEETQIYVCDINPNMLNVGKKRASERGYKEGHCLSWIQGDAEALSFEDGSMDGY
TIAFGIRNVTHIEKALSEAYRVLKRGGRFLCLELSHVDVPLFKEIYDVYSFSVIPAVGEL
VAGDRQSYQYLVESIRRFPNQEKFAQMIQEAGFERVEYENLVGGVVAIHSGLKL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggctctgcgatcggcggccggtaggctggcgtcgtccagccgccgccgcctcctctct
ccgcccaccagcatccacacggccttcctccactcccacgccaccagcttcggatacaag
caagtagctgaagaggacaaaagcaaattggtcggtaacgtcttcagcagcgtcgcctcc
agttacgatctcatgaacgatcttatgagcgttggactacataggttgtggaaggacagg
ctcatctcaaagcttaatccttttcctgggatgaagcatctagatgtggctggtggaaca
ggggatgttgccttccgtgcgctcgagagaatcaatagcgtgagccatagagctatgcag
ggtactcttactgatattgaagaagaaacacaaatctatgtttgtgacattaatccaaat
atgctgaatgttggaaagaaacgtgcttcagaaagaggatacaaagaaggccattgcctt
agctggatacaaggagatgctgaagctctgagttttgaggatggatctatggatggctat
actattgcgtttgggatcagaaatgtgacacacattgaaaaagctctatcagaagcttat
agagtcctaaagcgagggggaaggttcctatgcttggaattgagtcatgtggatgttccg
ctttttaaagagatttatgatgtttattcattttctgtgattccggctgtgggagaacta
gtggccggtgatcgccagtcataccaatacttggttgagagtatccgccggtttccaaat
caggaaaagtttgctcagatgatccaagaagccggatttgagagggtagaatacgaaaat
ctggtgggtggtgtggttgccattcactctggactgaaactgtag

DBGET integrated database retrieval system