KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324332
Entry
4324332           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4324332
  KO
K12865  polyglutamine-binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4324332
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4324332
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4324332
SSDB
Motif
Pfam: WW NPCBM_assoc Hydrolase_2
Other DBs
NCBI-GeneID: 4324332
NCBI-ProteinID: XP_015627394
UniProt: Q5N817 A0A0P0VC39
LinkDB
Position
1:complement(39938802..39944890)
AA seq 524 aa
MDNSHEQPLPPGVGAWPPPPSIHPAKFQPNPQPYATPYGATPNNGSNHNAASYSAAAQPT
MPFPNMDAGGAQSNQTAHEVSNHNDSAADIESAVQEAVLREQDIETQQVIQNQRQAKATI
EPTQYGEDLLSNRRNPNALKEHLLKMTAEHRAEMANKRGKPLHADNGNVEIGNGYGVPGG
GAYYAANMSSGQMNKPKDIADKAKGADDLPEFLRQRLRARGILKDEATNNRFTIKQNVDS
PVGQIKAAQELPPGWVEAKDPTSGASYFYNQSTGTTQWDRPGAPLNTMQHQAPPSSSLPE
NWEEALDQSTGQKYYYNTNTQATQWEPPTAVNPGVAPHAPTNAAVEMAAQNTDIWNSQMQ
RCLGCGGWGVGLVQPWGYCNHCTRVQNLPFQQYPSYPNNTTHSSSNKNPGNVAAKDRSSA
KPPFGKANRKDHRKRNRPEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAADTTAAGPLF
QQRPYPSPGAVLRKNAEVASHGKKRGMAPITKRGDGSDGLGEAD
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggataactcacacgaacagccattaccccctggtgtcggggcatggccgccgccacct
tccattcatcctgcaaaatttcaacctaatccacagccttatgcaacaccttatggcgct
acacccaacaatggcagcaatcacaatgcagcgagctactctgctgctgcacaacccacc
atgcctttccctaacatggatgctgggggtgcacaatcaaatcagacagctcatgaagtt
tccaaccataatgatagtgcagcagacattgaatctgctgtccaagaggctgttcttcgt
gaacaggacattgagactcagcaagtcatacaaaatcaaagacaagcaaaagcaacaatt
gagcctacgcagtatggagaagacctcctttcaaaccgccgcaaccctaatgcattgaag
gagcacttactaaaaatgacagccgagcatcgtgcagagatggcaaacaaaagggggaag
ccgcttcatgcagataatggcaatgttgaaattggcaatggctatggtgtaccaggaggg
ggtgcttattatgctgcaaacatgtcaagtggtcaaatgaataaacccaaggatatagct
gataaagcaaaaggtgccgatgatctccctgaatttttgaggcagagattaagagcaagg
ggtattcttaaagatgaggcgacaaataatagattcacgattaaacaaaatgtcgattct
ccagtagggcagataaaagctgcccaagagttgcctcctggttgggttgaagcaaaagat
ccaacaagtggtgcttcttatttctataatcagagcactggaacgacccaatgggatcgc
cctggtgctcctttgaacaccatgcaacatcaagctcctccatcctcgtccttgccagag
aattgggaggaggcacttgatcaatcaacaggccagaaatactattacaatacaaataca
caagcaacacagtgggagccgcctactgctgtgaacccaggtgttgcgcctcatgctccc
accaatgctgctgttgagatggctgctcaaaatacagatatttggaactctcaaatgcag
agatgtttaggctgtggtggatggggtgtaggtcttgtccagccatggggttattgcaat
cactgcacaagggttcaaaatcttccttttcaacagtatccatcctacccaaacaatact
acacactcaagcagtaacaaaaatccagggaatgtagcagccaaggacagatcaagcgca
aaacctccatttggcaaagcaaacagaaaagatcaccgcaaaagaaatcgccctgaggat
gatgagcttgacccgatggacccaagctcttactcagatgctccacggggtggctgggtt
gttggcttgaagggtgtgcagccacgggcagcagatactactgcagctggacctttattc
caacaaagaccatatccgtcacctggtgctgtgctgagaaaaaatgcagaggttgcatct
catggcaagaaacgtggtatggctccgatcaccaaaagaggggatggcagtgacggtctc
ggggaggcggattag

DBGET integrated database retrieval system