KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324336
Entry
4324336           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 2 isoform X1
  KO
K12879  THO complex subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4324336
  09122 Translation
   03013 Nucleocytoplasmic transport
    4324336
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4324336
   03041 Spliceosome [BR:osa03041]
    4324336
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     4324336
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4324336
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4324336
SSDB
Motif
Pfam: Tho2 THOC2_N Thoc2
Other DBs
NCBI-GeneID: 4324336
NCBI-ProteinID: XP_015615751
LinkDB
Position
1:complement(39960255..39976012)
AA seq 1779 aa
MSPPLQAPDYKHVTEECLREWKGQPAAAAAFRVPDPVPMARFLYELCWAVVRGDLPPQKC
RVALDSVEFVEEAQRGEVGSVLADIIAHLGQDVTISGEYRSRLVKMTKSFVESSLIAPRL
LQERCEEEFLWEVELSKSKGQDLKAKEVRVNTRLLYQQTKFNLLREESEGYAKLVTLLCQ
IGSDLACQNSSSVTMSIIKSLIGHFDLDPNRVFDIVLECFELYPDNTIFCQLIPLFPKSH
AAQILGFKFQYYQRLDVNSTVPPGLFRIAALLVKSGFIDLDSLYAHLLPNDDEAFEHFDS
FVTRKIDEASNIGKINLAATGKDLMDDEKQEITIDLYTALEMENDIIDERAPEIEKNQKL
GLLLGFLSVHDWDHAQLLFERLARLNPVEHVEICDSLFRLIERSISSVYDIIFQTHYKMP
RNPVYMMDTSPSSSQSFSVDPPKEFFQMLSACGPYLHRNTQLFQKVCRVLKAYHLSAKES
IRTAGVMSPDSRIEEALGSCLLPSLQLIPANPAVDMEIWGVLSLLPYETRYRLYGEWEKD
TEQNPIVLAARQTAKLDTRRLLKRLAKENLKQLGRMVAKLAHANPMTVLRTIIQQVEAYR
DMITPVVDAFKYLTQLEFDILQYIVIERLAQGGREKLKDDGLNLSDWLQCLASFWGHLCK
KHHSVELRSLFQYLVNQLKKDTGIELVVLEELIQQMANVQYTENMTEEQVDAMAGSETLR
LQASSLFGSTRNSKVLTKSTNKLRDSLLPKEEPKLAIPLLLLIAQHRSKIIINADATYIK
MVSEQFDRCHGILLQYVEFLSTAVTPTTYVQLIPPLEDLINKYHIEPDVAFLIYRPVMRL
FKSTNGGDTYWPLDDNEEGESVSCDDLILHPDTSHKSIMWSDLLSTVRNTFPAKTWNGLS
PDLYATFWGLTLYDLHFPKDRYDAEIKKLHENLKQLEDNSDNSSIAISRRKKDKERIQDL
LDKLNNESHKHQQHIASVLQRLGREKVKWLNSSPDALKINMEFFQRCIFPRCVFSMQDAV
YCAMFVQTLHSLETPFFNTVNHIDVFICKTLQPMICCCTEYEAGRLGRFLHETLKMAYRW
KSDESLYERECGNKPGFAVYIRYPNSQRVSYSQFVRVHWKWSGRITKVLNQCMESKEYME
IRNALIVLTKISSIFPVIRKSGVNLEKRVAKLKGDEREDLKVLATGVAAALAARKSSWLS
EEEFGMGLLDLKQGPAKIVPGNQSADPLTAKDQSVRAKSIEGRHERSEAAMKPDAQQKKN
ALAANGSDNQMPSSSAQGKVSGIIRGSDEPPKLLSDEGVKVSKPTAESETRVPQKRVAHN
AGKVSKHDMVKEDTKSGKSTNRGVTQQGSSVPVDKEVLSQAADGVQDTTSNSLAASNGNL
HTAPRKVSASSQKSTLLATHTGGAANSSGESTDLIDSNMKQQKRFVPTEEQDRGTKWRKG
ESEGRDGDFTEHTDKDRNLDSRLVDKFRPMDHDKSASEEQILSRPEKSKEKADDKYDRDP
REKADRTERRRGEDIERPTDKSLERRERSIERMQERGTDRAPDKGREDRNKEERNKVKHA
EPSIDRAHPSDERFRGQSLPPPPPLPASFVPQSVGNRRDEDTDRRGGSTRHNQRSSPRRD
DKEKWHLEDNAASLQDDGKHRREEDIRDRKREDRDVSSSKVDDRDRDKSSIVKDESDPNS
ASKRRKIKRDQSGLEAGEYAPSAPQLPSHGTSSSQVFETRERERKGAISQHRISHADDLP
RIHGKDSSKTSRREADQVHEREWEEEKRSRTETKRKHRK
NT seq 5340 nt   +upstreamnt  +downstreamnt
atgtcgccccctctccaggcgcccgactacaagcacgtcacggaggagtgcctccgcgag
tggaagggccagcccgccgccgccgccgccttccgcgtccccgatccggtccccatggcg
cgcttcctctacgagctctgctgggcggtggtgcggggggacctgccgccgcagaagtgc
cgggtggctctggactcggtggagtttgtggaggaggcgcagcgaggggaggtcggctca
gtactcgccgacatcatcgcccacctagggcaggatgttacaatctctggtgaatatcgc
agccgtcttgtcaaaatgaccaaatcatttgtggagtcgtcattgattgcgcctaggctc
cttcaagagcgatgcgaggaagagttcctctgggaggttgaactgagtaagtcaaagggg
caggatttgaaggctaaggaggtcagggtcaacacacgtctcctttatcagcaaactaaa
ttcaaccttttaagagaggaaagtgagggctacgccaaattggtaaccctcctttgtcaa
attggttcagatttggcttgtcaaaattcttcttcagttactatgagcattataaagtca
ttgattgggcattttgacctggacccaaatcgtgtgtttgatattgttctggaatgtttt
gagctctatccggataataccatcttttgtcagcttatacctcttttccctaagtcccat
gctgctcaaatattggggttcaagttccaatattaccaacgattggatgtcaatagcact
gttccacctgggcttttccggatagcagctttgttggtcaaatctggttttattgacctt
gatagcctctatgctcatttacttccaaatgatgatgaggcatttgagcattttgactcc
ttcgtcacgaggaaaatcgatgaggctagtaatataggcaaaataaatcttgctgccact
gggaaggaccttatggatgacgagaagcaagaaataactattgatttgtacacagcattg
gagatggaaaatgatataattgatgagcgagcccctgagattgaaaagaaccagaaactt
ggacttcttcttggtttcctgtcagttcatgattgggatcatgcacaactcctctttgag
cgtcttgcacgcctaaatcctgttgagcatgttgaaatttgtgatagtttatttagactt
attgaaaggagtatttcttcagtctatgatataattttccaaacacattataagatgcct
cgtaaccctgtttatatgatggacacatcaccttcctcttcacaaagtttttcggttgat
ccgccgaaagagtttttccaaatgctttctgcttgtggaccataccttcatcgtaacaca
caattatttcagaaggtttgcagagtacttaaagcgtaccatctgtcagcaaaagagtca
atccgtacagcaggtgtaatgtctccagactcgcgaattgaagaagcacttggatcgtgc
ttgctaccatcattgcagcttatacctgcaaatcctgctgttgatatggagatatgggga
gttctttctcttcttccttatgagacccgttatcgcttatatggtgaatgggagaaggat
accgaacaaaacccaattgtccttgctgcaaggcaaactgcaaagttggataccagaagg
ctcttaaagcggcttgctaaggaaaatctgaagcaacttggccgcatggtggctaaactt
gcccatgcaaatccaatgacagtacttcggacaattatccaacaggttgaagcatatagg
gacatgataactccagtcgtcgatgcttttaaatacttgactcagctggagtttgacatc
ttgcaatatattgtaattgaacgcttggctcaaggtggccgtgagaaacttaaagatgat
ggtcttaatctatctgattggcttcagtgtcttgcatcattctgggggcacctgtgcaag
aagcatcattcggtggagctaagaagcctttttcagtaccttgttaatcagctgaagaaa
gacacaggcattgagcttgttgtactcgaggaactcattcagcaaatggcaaatgtgcaa
tacactgagaacatgactgaggagcaggttgatgctatggcagggagtgaaacattgcgg
cttcaagcttcatcactatttggatcaacaagaaattctaaggttctgaccaagtctaca
aacaaattgagggattctttgcttccaaaagaagaacctaaacttgccattcccctttta
ctgcttattgctcagcatcgatccaagattataattaatgctgatgccacatatatcaaa
atggtcagtgagcagtttgatcggtgccatggaatactacttcagtatgttgagtttctt
tcaactgcagtaactccaacaacttatgttcaactaatacctccgctggaagatctgatt
aataagtatcatatcgagcctgacgttgcttttcttatataccgacctgtgatgagactt
ttcaaaagcactaatggaggtgacacctattggcctttggatgacaatgaagaaggggag
tctgtatcatgtgatgatctgatattgcatcctgacacatctcataagtcaatcatgtgg
tctgatcttcttagcacagtccggaacactttcccagcaaaaacctggaatggtttatca
cctgatttatatgctactttctgggggttaacactatatgatcttcatttccccaaagat
cgttatgatgcagaaataaagaagctgcatgaaaatcttaaacaactggaagataattcg
gataactctagtattgcaatctcacgacgcaagaaggacaaggagagaatccaagatttg
cttgacaaattgaacaatgaatcacataagcaccaacaacacattgcatcagtgctccaa
aggctaggtcgtgaaaaggttaagtggttaaattccagtccagatgctctgaagatcaac
atggaatttttccagcgctgcatattccctcgctgtgtttttagcatgcaagatgctgtg
tattgtgctatgtttgtccaaacactgcactcactcgagactccatttttcaacacggtg
aatcatatcgatgttttcatctgcaaaactctacagccaatgatttgttgctgcacagag
tatgaggctggcaggctgggaaggtttcttcatgagacactgaagatggcctaccgttgg
aagagcgatgaatctttatatgagcgtgaatgtggaaataagccaggtttcgctgtgtac
atcagatatccaaatagccagcgtgtatcttatagccagtttgttcgagttcattggaag
tggagtggacgaataactaaggtgctgaaccagtgcatggaatcaaaagaatacatggaa
atcagaaacgcccttattgtgctcacaaagatatctagcatttttcctgtgatacgcaaa
agtggagtcaatcttgagaaacgtgttgctaagctgaagggggatgaaagggaagatctg
aaagttctggcaactggtgtagctgctgctttggcagcccgcaagagctcatggctatct
gaagaagagttcggcatgggtctccttgatcttaagcaagggccagcaaaaattgtgcct
ggaaatcaatcagcagatcctttgacagcaaaagatcagagtgttcgtgcaaaatccatt
gagggtaggcatgaacggtcagaagctgccatgaagcctgatgctcaacaaaagaaaaat
gccttggctgcaaatggatctgataaccaaatgccatcttcttctgcacaaggaaaagtt
tcagggattatacgaggttctgatgaacctcccaaacttctatctgatgagggagttaag
gtttcaaagcctactgcagaatctgagacaagggtgccccaaaagcgtgtggcacacaat
gctggcaaggtatctaagcatgatatggtaaaggaagatacaaaatctgggaaatctaca
aacagaggtgttactcaacaaggctcctctgttcctgttgataaagaagtattgtctcag
gcagctgatggtgtgcaagataccaccagtaattctttggctgctagcaatggtaactta
catacggctccacggaaggtatcagcatcctcccaaaaatcaacactgttggctacacat
actggtggagcagctaattcctctggtgaatctactgacttgattgactctaatatgaaa
cagcaaaagaggtttgttcctactgaagaacaagatagaggaactaaatggaggaaagga
gagagtgaaggccgggatggtgacttcacagaacacactgacaaggacagaaatttggac
tcgcgattggtagataaatttcgtcccatggatcatgacaagagtgctagcgaggaacaa
atcctaagtaggccagagaaatcaaaagaaaaggctgatgacaaatatgaccgggatcct
agagaaaaagcagatcgaactgagaggcgtcgaggggaagacatcgagagaccaacagac
aaatcattggaaaggagagagcgttctattgaaagaatgcaagaaagagggacagataga
gctcctgataaaggaagagaagacaggaataaggaggagagaaataaagttaagcatgct
gaaccatccatagatcgtgcacatccttctgatgaacggttccgaggacaaagcttgcca
ccacctccaccccttccagcaagttttgtaccccaatcagttggtaacaggagagatgaa
gataccgatcgaaggggtggtagtactaggcataaccaacgatcatctcctaggcgtgat
gataaagaaaagtggcacttggaggacaatgctgcgtcgttgcaggatgatggaaagcac
cggagagaggaagatattcgggacagaaagcgtgaagatagggatgtttcgtcaagcaag
gtagatgaccgggatagggacaaaagtagtattgtgaaggatgaaagtgatcctaatagt
gcttccaaacggcgaaagatcaagagagatcagtctggtttagaagctggggaatacgca
ccttctgctccacagcttcccagtcatggaaccagtagctcacaagtgtttgaaacacga
gagcgagaacgaaagggggcaatttcacagcatcggatatcccatgctgatgaccttcct
agaatacatggaaaggactcgagcaagacaagtcgtagagaggctgaccaagtacatgag
agagaatgggaagaggaaaagcgatcaagaacggaaactaaaaggaagcaccggaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331353
Entry
4331353           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 1
  KO
K12878  THO complex subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4331353
  09122 Translation
   03013 Nucleocytoplasmic transport
    4331353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331353
   03041 Spliceosome [BR:osa03041]
    4331353
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     4331353
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4331353
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4331353
SSDB
Motif
Pfam: efThoc1
Other DBs
NCBI-GeneID: 4331353
NCBI-ProteinID: XP_015627836
UniProt: Q10SU9 Q0DVV9
LinkDB
Position
3:602449..609350
AA seq 638 aa
MAEPTPPLPSNAGLRILLSKDRPPASSSSALAAATSAAVSSHTDRDRIIGVFRDALSRTE
SPEAFALQAVQDAIKPQKQTVLVLEENQSLENALRKLLQELASSAVQSGKRIMQYGDNEE
NNCPITRLLDIVLYLCERGHVEGGMVFQLLEDLTEMSTIKDCKDVFGYIESKQDVLGKQE
LFGRGKLVMLRTCNQLLRRLSKANDVVFCGRIIMFLAHFFPLSERSALNIKGVFNTSNET
KYEKDATDGISVDFNFYNTLWSLQEHFSNPALTAANLTRWQKFVSNLTVVLSTFEAQPLS
DDDGKLNNLDQEEDAAFNIKYLTSSKLMGLELKDPSFRRHILVQCLIFFDFLKAPGKTDK
EGPTGSMKEEIDSCEERVKKLLEIIPPKGKDFLQSIEHILEREKNWVWWKRDGCLAFEKQ
PFEKKPGQAGVRKRKPRWRLGNKELAQLWKWAEQNPNALTDSERICMPSVTEYWKPLAED
MDPSAGIEDEYHHKNNRVYCWKGLRFSARQDLEGFSRFCDYGIEGVVPQELLPPEVRSKF
YSKPGDKAKRPKREDPKGTSAQPKEQQVVSATPETDGGGSGAEPEEGAVPMDSDNAAIDE
GRKQSPEEVSGPESGQCEAEADGEDNMKNEASKDGPSA
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggcggagcccacgccgccgctgccgtcgaacgccgggctccgcatcctcctcagcaag
gaccggccaccggcctcctcttcctccgcgctcgccgccgccacctccgccgccgtctcc
agccacaccgaccgcgaccgcatcatcggagtgttccgggatgcgctgtctaggactgaa
tcccctgaagcttttgcccttcaggccgttcaggatgcgattaaacctcagaagcaaaca
gtgttggttctggaggagaaccaatccttagaaaatgctctacgcaaattgctgcaggaa
cttgcatcatctgcagttcaatctggtaaaagaataatgcaatatggggataatgaagaa
aataattgcccgataacacgtcttcttgatatcgtgctttacctttgtgaaagagggcat
gttgagggaggtatggtattccagctgttagaagatctgacagaaatgtcaactatcaaa
gactgcaaagatgtatttggatatattgagagcaaacaagatgtcttggggaagcaagag
cttttcgggcgtggcaagcttgttatgctaaggacttgcaaccaactacttcgaagatta
tcaaaggcaaatgatgtggtattctgcggacgtattatcatgtttctagcacatttcttc
ccattatcggaacgttcagctctcaatatcaagggggtttttaacacatcaaatgaaaca
aagtacgagaaagacgctacagatggaatttctgttgatttcaacttctacaatacccta
tggagtctgcaggagcattttagtaaccctgctttaactgctgcaaatctgacaagatgg
caaaagtttgtgtccaatttaacggttgtgctaagcacatttgaagctcagcctctcagt
gacgatgatggaaaacttaacaatcttgaccaagaggaagatgctgctttcaatattaag
tacctgacaagtagtaaattgatgggtttggagttgaaggacccaagttttcgacgccac
atccttgtccagtgcctcatattcttcgactttctcaaggcacctggaaagactgacaaa
gaaggtccaactgggagcatgaaagaggaaatcgattcttgtgaagagcgtgttaagaaa
cttctggagataattccaccaaaagggaaggacttcctacaaagcatcgagcatattctt
gagcgggagaaaaattgggtatggtggaaacgagatgggtgtctagcgtttgaaaaacaa
ccttttgaaaagaaaccaggccaagctggagtcagaaaacgtaagccaaggtggagattg
ggaaacaaagaacttgcccaactgtggaaatgggctgaacaaaaccctaatgctctgact
gattctgaacgtatttgcatgccatcagtaacagaatattggaaaccacttgcagaagat
atggatccatctgctggtattgaggatgaatatcaccacaagaataatcgtgtgtattgc
tggaaagggttacgattttcagccaggcaggatttggaaggtttttctcggttttgtgat
tacggtattgaaggagttgtacctcaagaactgttgccacctgaagtccgttccaagttt
tattcgaagcctggtgacaaggctaaacgacctaagagggaagacccaaaaggcacttca
gcccaacccaaggaacaacaggttgtttcagccacaccggagaccgacggtggcggtagc
ggggctgaaccagaagaaggtgctgtgccaatggattctgataatgccgcgatcgatgaa
ggccggaagcagagcccagaggaggtgtctggacctgaaagcgggcagtgcgaggctgaa
gccgatggcgaagataacatgaaaaatgaggctagtaaagacggtccatccgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332426
Entry
4332426           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 4A
  KO
K12881  THO complex subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332426
  09122 Translation
   03013 Nucleocytoplasmic transport
    4332426
   03015 mRNA surveillance pathway
    4332426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4332426
   03041 Spliceosome [BR:osa03041]
    4332426
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4332426
    TREX complex
     4332426
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4332426
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4332426
SSDB
Motif
Pfam: RRM_1 FoP_duplication RRM_3
Other DBs
NCBI-GeneID: 4332426
NCBI-ProteinID: XP_015630777
UniProt: Q10N90 A0A8J8Y671
LinkDB
Position
3:complement(9449419..9453113)
AA seq 273 aa
MAETLDMTLDDIIKNNKKANPSSGRGRRGSAAGGGGGGGGGVGGGGGGGVGPTRRPFKRS
GNRAGPYQPPKAPESAWQHDMYSDVAAGGGGGSGGGGRVSAIETGTKLYISNLDFGVSTE
DIKELFSELGDLKKYVIHYDRSGRSKGTAEVVFARRGDAVAAVKKYNNVQLDGKPMKIEI
LGTNTPTAAAALPANNGGYVRNVAKSAPRGGPAGLPQGRPRPRGGGRRRGGGGGSGGPGG
SGGRRGKERSQPKSAEELDADLEKYHADAMQTN
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcggagaccctcgacatgacgctcgacgacatcatcaagaacaacaagaaggccaac
ccctcgtccggccgcggccgccgcggatctgccgctggcggcggcggcggcgggggtggg
ggtgttggtggtggcggcggcggcggcgtggggccgacgaggcggcccttcaagaggtcg
gggaacagggcggggccctaccagccgcccaaggcccctgaatcggcgtggcagcacgac
atgtactcggatgtcgcggcaggcggcggcggcggcagcggcggaggcgggagggtctcg
gctatcgagactggcaccaagctctacatctccaatttggacttcggcgtctcgaccgag
gatatcaaggagcttttctctgaattaggtgatcttaagaaatacgtaattcactatgac
agaagtgggaggtctaagggaacagctgaagttgtatttgcaaggcgtggcgatgctgtc
gcagcagtgaagaaatataacaatgtgcaacttgatggtaagccaatgaaaatagagatt
cttgggaccaatactcctacagctgcagctgctcttccagcaaataacggaggctacgtt
agaaatgttgctaagagtgcaccaaggggtggcccagctggactaccgcagggtagacct
cgtccaagggggggtgggaggcgccgtggtggcggaggaggcagtggtggtcctggtgga
tccggtggtcgccgtggcaaagagcgtagccagccaaagtctgctgaagaacttgatgct
gacttggagaaataccatgcagatgcgatgcagaccaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340675
Entry
4340675           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 4D
  KO
K12881  THO complex subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4340675
  09122 Translation
   03013 Nucleocytoplasmic transport
    4340675
   03015 mRNA surveillance pathway
    4340675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4340675
   03041 Spliceosome [BR:osa03041]
    4340675
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4340675
    TREX complex
     4340675
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4340675
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4340675
SSDB
Motif
Pfam: RRM_1 FoP_duplication RRM_3
Other DBs
NCBI-GeneID: 4340675
NCBI-ProteinID: XP_015644210
UniProt: Q652G7 B9FSK8
LinkDB
Position
6:complement(8129435..8134498)
AA seq 294 aa
MATSLDMSLDDMIKNNRNSRGRGRGRSQGGGRGRGDGQRFSYGSGRGRGAGTFRGRGVGV
PSRRPLGVSTRSSSYAIAKSFNKTKDIVWRQDLFEDSMVAAGLSVTESSTKLYISNLHYG
VTKEDIQELFSEMGHLKHCAVHYDNNRRPTGSAEVIFTRRSEAVAALKRYNNVRLDGKPM
KIEVIGADLGMAAPSAPRVSVVPGARGRGQREVVMMPGGSGFGRGAAGSSNFIPGWKRNN
FAQRGGQGRGRGRGRNNFGRGRGRGYVRKGPVEKSAEQLDKELDSYHSGAMNVD
NT seq 885 nt   +upstreamnt  +downstreamnt
atggcgacatctttggatatgtcactggacgatatgattaagaacaacagaaattctagg
gggagaggaaggggtaggtcacagggaggaggtcgaggcagaggtgatggccaaaggttc
agctatggttcagggcgtggacgtggtgctggcaccttccgtggaaggggagtaggagtg
ccttcacgaaggccacttggtgttagtactcggtcatcatcgtatgctattgccaagtca
ttcaacaaaaccaaggatattgtatggaggcaagatctgtttgaggacagcatggttgct
gctggcctttctgtgacagaatctagtacaaagctgtatatttcaaacttgcactatgga
gtgacaaaagaagatatacaggaacttttttccgagatgggtcatttgaagcattgtgct
gttcattatgataacaatagacgcccaactggttcagctgaggtgatattcactaggagg
agtgaagcagttgcggctttaaaacgatataataatgtgcgccttgatgggaagccaatg
aagatcgaagtgataggagcagatttgggtatggctgctccttcagcaccccgtgttagt
gttgtccctggtgcaaggggtagaggacagcgagaagttgtaatgatgcctggtgggagt
gggtttggtcgaggtgcagctggttcatctaatttcattcctgggtggaagcgtaacaat
tttgcacaaagaggtgggcaaggccgaggtcgtggccgtggacgtaataactttgggcgt
gggcgtgggcgtggctatgttcggaagggacctgtggagaaatcagctgagcaattggac
aaggagctggatagctatcattccggggcaatgaatgtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342793
Entry
4342793           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 4A isoform X1
  KO
K12881  THO complex subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4342793
  09122 Translation
   03013 Nucleocytoplasmic transport
    4342793
   03015 mRNA surveillance pathway
    4342793
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4342793
   03041 Spliceosome [BR:osa03041]
    4342793
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4342793
    TREX complex
     4342793
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4342793
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4342793
SSDB
Motif
Pfam: RRM_1 FoP_duplication RRM_3
Other DBs
NCBI-GeneID: 4342793
NCBI-ProteinID: XP_015646999
LinkDB
Position
7:complement(7627360..7635965)
AA seq 277 aa
MSSGLDMSLDDLIKQSKTKPKGGAPSSSGPTRRAAPPAARAAPYPPAGPKAAGGASPYGV
YSEHVAAMAGVVPRPRPPPAAAAAAARSLETGTKLHISNLDPGVTVDDVQELFSEIGELK
RYSVNYDKDGKSQGTAEVVFARKVDALEAIKRYDGVILDGNPMKIDLIGNNSETSPMPPT
APLLYNPPFPNYPNSVPRRGGQRGQFHQGNGRPGNSQGIGGGPRGFQGSGRPGSGSQGGG
GCSQGKTRGNERSRIQKSAADLDAELDQYHAEAVKEK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtcgagtggcctggacatgtccctggacgacctcatcaagcagtccaagaccaagccc
aagggcggggccccctcctcgtcggggcccacccgccgcgcggcgccgccggcggcgcgc
gcggcgccgtacccaccggccggccctaaggccgccggcggcgcttcgccgtacggggtc
tactccgagcacgtggccgccatggcgggggtcgtgccgcggccgcggccgccgccagcc
gccgccgccgccgccgcgcggtctctggagaccgggacgaagctgcacatctccaacctc
gaccccggcgtcaccgtcgacgacgtccaggagctcttctcggagattggtgagctcaaa
cgctattctgttaactatgataaggatggaaaatcacagggaacggcagaagttgtgttt
gcaagaaaagtggatgctttggaggctattaagagatatgatggtgtaatacttgatggt
aaccccatgaagatagatctcatcggaaataattctgagacatccccaatgcccccaaca
gcacctttgttgtacaatccaccttttccgaactaccctaacagtgtaccacggagaggt
ggccaaagaggacaatttcatcaaggtaatggtcgccctggaaacagtcagggcattgga
ggtgggccaagaggatttcaaggtagcggtcgtcctggaagcggtagtcagggcggtggt
ggctgcagccaggggaaaacccgtggaaatgaacggagtcgcatacaaaaatcagctgca
gatcttgatgctgaattggaccagtatcacgcagaagcagtgaaggagaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345621
Entry
4345621           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 4D isoform X1
  KO
K12881  THO complex subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4345621
  09122 Translation
   03013 Nucleocytoplasmic transport
    4345621
   03015 mRNA surveillance pathway
    4345621
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345621
   03041 Spliceosome [BR:osa03041]
    4345621
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4345621
    TREX complex
     4345621
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4345621
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4345621
SSDB
Motif
Pfam: RRM_1 FoP_duplication RRM_3
Other DBs
NCBI-GeneID: 4345621
NCBI-ProteinID: XP_015649900
UniProt: Q0J5K6 Q7EY69
LinkDB
Position
8:complement(20578930..20583507)
AA seq 286 aa
MAYYARRGGDRVSGGGRVQGGGGGGGGGGRGGYVLRGRSGMPPRGPLGLGVNSRPSARTI
AKSFSRTKDMTWRPDLFSDSMAASGIETGTKLYISNLDYGVSNEDIKELFSEVGHLKRFA
VHFDGYGRPNGTAEVVFTRRSDAIAALKRYNNVLLDGKAMKIEVIGSDLGLPMTPRINVV
GASNGRPTRTVVMTPEIGQRGSGSSSRPTGPTVNRYNRGAFQAGRGRGRGRGRAPFQSQF
QGRGTGSVRGRGQFQGRGRGRRQAGKTADELDKDLETYHAEAMKTD
NT seq 861 nt   +upstreamnt  +downstreamnt
atggcgtattacgccaggaggggtggggatagggttagtggtggtggccgtgttcaaggt
ggtggaggtggtggaggtggtggtgggagaggtggatatgtgctgcgtggaagatcaggg
atgcctcctcgagggccccttggcctcggggttaactcgcggccatcagcgcgcactatt
gctaagtcttttagcagaaccaaagacatgacctggagacctgatctgtttagtgatagt
atggcagctagtggaattgaaactggtacaaaattgtacatttcaaacttggactatggg
gtttccaatgaggatataaaggagctgttttcagaagttggtcacttgaagcgctttgct
gttcactttgatggttatgggcgcccaaatggcacagcagaagtggtgtttactaggaga
agtgatgcaattgctgcattgaaacgttacaataatgttctgcttgatggtaaagctatg
aagatagaagttattggaagtgacttaggtttgcctatgacacctcgcataaatgtggtt
ggggcttctaatggcagacctacaagaacagttgttatgacgcctgaaattggccagcgt
ggcagtggttccagcagtagaccaacaggtcctacagttaatagatataaccgtggtgcc
ttccaagctggccggggccgaggccgtggcaggggtcgtgccccattccagtcccagttc
cagggccgtggcactggcagtgtcaggggccgtggtcaattccagggccgtggtcgcgga
aggaggcaagctgggaagactgcagatgagctggacaaagacctggaaacttatcatgct
gaggcaatgaagaccgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346657
Entry
4346657           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 3
  KO
K12880  THO complex subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4346657
  09122 Translation
   03013 Nucleocytoplasmic transport
    4346657
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4346657
   03041 Spliceosome [BR:osa03041]
    4346657
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     4346657
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4346657
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4346657
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A DUF2121
Other DBs
NCBI-GeneID: 4346657
NCBI-ProteinID: XP_015610692
UniProt: B9G2Q3 Q69VQ7
LinkDB
Position
9:7271233..7276922
AA seq 332 aa
MEGKEDDRRRGGGGGSSTPGMNLKNLVSREYFGHKKKVHSVAWNCLGMKLASGSIDHTAR
VWSIDPHGHSKVKDIELKGHTDCVDQLCWDPKHPDTVATAAADKSIRLWDARSGKCQVVE
LSGENINITYKHGGTQIAVGNKEDELTIVDVRKLKALHKFKFNYEINEIAWNKTGDLFFI
TTGLGNVEVFGDPSLDDTLHVVGKLNAHTAGCYCIGMDPLDRYFAVGSADSLVSLWDVKE
LLCIKTFTKLEWPVRTVSFNHTGEFLAYASEDPFIDIANVQTGRSIHQIPCKAAMNSVEW
NPKYNLLAYAGDDKNKYQADEGVFRIFGFEST
NT seq 999 nt   +upstreamnt  +downstreamnt
atggaggggaaagaagacgacagacggcggggcggcggtggcggaagctcgacgccgggg
atgaacctgaagaacctggtgtcgagggagtatttcggccacaagaagaaggtgcactct
gtagcatggaactgcctaggcatgaagcttgcttcaggctctattgatcatactgcacgt
gtatggagtatcgatccccatggccattccaaggttaaagacattgaattgaaaggccac
acagattgtgtagatcagctctgctgggatccgaagcatcctgatacagttgctacagca
gctgctgacaagtcaattcgcctctgggatgcacggagtggaaaatgtcaagtcgtcgaa
cttagtggagaaaacatcaatatcacttataaacatggtggtactcaaatagctgttgga
aacaaggaggatgagttgacaatagtggatgttcggaagctaaaagcccttcacaaattt
aagtttaattatgagataaatgagattgcatggaacaaaactggagatttattcttcatc
actactggacttggaaatgttgaggtatttggtgatccttcccttgatgacacccttcat
gtggttggcaaattgaatgctcatacagcgggttgttattgcattggaatggatcccctt
gataggtattttgctgttggaagtgcagattcacttgtcagtctttgggatgtcaaagag
ctcctttgcattaaaacctttaccaaactcgagtggcctgtaagaacagttagcttcaat
catactggagagtttcttgcatatgctagcgaagatcccttcattgacattgccaatgtt
caaactggacgatcgattcatcagattccatgcaaggcagctatgaatagtgttgaatgg
aaccccaagtacaacctcctggcttacgcaggagacgacaagaacaagtaccaggctgat
gaaggtgttttccgaatatttggctttgaaagcacataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349526
Entry
4349526           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 4A isoform X1
  KO
K12881  THO complex subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4349526
  09122 Translation
   03013 Nucleocytoplasmic transport
    4349526
   03015 mRNA surveillance pathway
    4349526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4349526
   03041 Spliceosome [BR:osa03041]
    4349526
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4349526
    TREX complex
     4349526
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4349526
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4349526
SSDB
Motif
Pfam: RRM_1 FoP_duplication RRM_3
Other DBs
NCBI-GeneID: 4349526
NCBI-ProteinID: XP_015617723
LinkDB
Position
11:4347..7034
AA seq 233 aa
MAADSLDMSLDDLITNKYKRRSRPDPAPSARRFHSRAATRAAAAPYHAITFQAPPTAYTH
PTPVETGTKLHISNLDYAVSNEDIKELFSEVGDVKRYSINYDKSGRSKGTAEVVFSRKSD
ALAAVKRYNNVQLDGKPMKLELIGINIEPPPPAMFGFAAPAGYFDFPPKSAEIFSGPGRG
GRGWPRGRGGFGGRGRGHVGRGRGRGDRGSRKISAEDLDADLDKYHAEGMQMS
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcggcggactcgctggacatgtccctcgacgacctcatcaccaacaagtacaagcgc
cgctcccgtccagatccagcgccctctgcccgccgcttccactcccgcgccgccacccgc
gctgctgccgctccctatcacgccatcacctttcaggcgccgcccacggcctacacccac
ccgacgcccgtcgagaccggcaccaagctccacatctccaacctcgactacgccgtctcc
aatgaggacatcaaggaactcttctctgaggttggcgatgtcaagcgttactctattaac
tatgacaagagtggaagatccaagggaactgcagaggttgtattttccagaaaatctgat
gccctggctgctgttaagagatacaacaatgtgcagctggatggcaaacctatgaaactt
gagctcattggtataaatattgagccaccaccacctgctatgtttggtttcgctgcacca
gctggatacttcgattttcctcccaaaagtgctgaaattttcagtggacctggcaggggt
ggaagaggatggcctcggggcaggggtggatttggtgggcgtggtcggggtcatgtgggt
cgtgggcgagggaggggagaccgtggaagtcggaagatttctgctgaagacctggatgct
gacttggacaagtaccatgcggaaggaatgcaaatgagctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351236
Entry
4351236           CDS       T01015                                 
Name
(RefSeq) THO complex subunit 4A isoform X1
  KO
K12881  THO complex subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4351236
  09122 Translation
   03013 Nucleocytoplasmic transport
    4351236
   03015 mRNA surveillance pathway
    4351236
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4351236
   03041 Spliceosome [BR:osa03041]
    4351236
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4351236
    TREX complex
     4351236
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4351236
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4351236
SSDB
Motif
Pfam: RRM_1 FoP_duplication RRM_3 Kdo_hydroxy
Other DBs
NCBI-GeneID: 4351236
NCBI-ProteinID: XP_015620448
LinkDB
Position
12:2686..5426
AA seq 237 aa
MAADSLLDMSLDDLITNKYKRRSRPGPAPSARRSHSRAATRSAAAPYHAITFQAPPTAYV
HPTPAANVETGTKLYISNLDYAVSNEDIKELFSEVGDVKRYSINYDRSGRSKGTAEVVFS
RKSDALAAVKRYNNVQLDGKPMKLELIGINIEPPPPAIFGFAAPAGYFDFPPKSAEIFSG
PGRGGRGWPRGRGGFGGRGRGHVGRGRGRGDRGSRKISAEDLDADLDKYHAEGMQMS
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcggcggactcgctgctggacatgtccctcgacgacctcatcaccaacaagtacaag
cgccgctcccgtccaggtccagcgccctctgcccgccgctcccactcccgcgccgccacc
cgctccgctgccgctccctatcacgccatcacctttcaggcgccgcccacggcctacgtc
cacccgacgcccgcggccaacgtcgagaccggcaccaagctctacatctccaacctcgac
tacgccgtctccaacgaggacatcaaggaactcttctctgaggttggcgatgtcaagcgt
tactctattaactatgacaggagtggaagatccaagggaactgcagaggttgtattttcc
agaaaatctgacgccctggctgctgttaagaggtacaacaatgtgcagctggatggcaaa
cctatgaaacttgagctcattggtataaatattgagccaccaccacctgctatttttggt
ttcgctgcaccagctggatacttcgattttcctcccaaaagtgctgaaattttcagtgga
cctggcaggggtggaagaggatggcctcggggcaggggtggatttggtgggcgtggtcgg
ggtcatgtgggtcgtgggcgagggaggggagaccgtggaagtcggaagatttctgctgaa
gacctggatgctgacttggacaagtaccatgcggaaggaatgcaaatgagctag

DBGET integrated database retrieval system