KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324364
Entry
4324364           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphate synthase 1
  KO
K00696  sucrose-phosphate synthase [EC:2.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324364
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.14  sucrose-phosphate synthase
     4324364
SSDB
Motif
Pfam: Glycos_transf_1 S6PP Glyco_trans_1_4 Sucrose_synth Glyco_trans_4_4 Glyco_transf_4 DUF1752 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4324364
NCBI-ProteinID: XP_015621705
UniProt: Q0JGK4
LinkDB
Position
1:complement(40101422..40107260)
AA seq 1084 aa
MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG
PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ
LELEGILRISARRKEQEQVRRETSEDLAEDLFEGEKADTVGELAQQDTPMKKKFQRNFSE
LTVSWSDENKEKKLYIVLISLHGLVRGDNMELGRDSDTGGQVKYVVELARALAMMPGVYR
VDLFTRQVSSPEVDWSYGEPTEMLTSGSTDGEGSGESAGAYIVRIPCGPRDKYLRKEALW
PYLQEFVDGALAHILNMSKALGEQVSNGKLVLPYVIHGHYADAGDVAALLSGALNVPMVL
TGHSLGRNKLEQIMKQGRMSKEEIDSTYKIMRRIEGEELALDAAELVITSTRQEIDEQWG
LYDGFDVKLEKVLRARARRGVSCHGRFMPRMVVIPPGMDFSSVVVPEDTSDGDDGKDFEI
ASPRSLPPIWAEVMRFLTNPHKPMILALSRPDPKKNITTLVKAFGECRPLRELANLILIM
GNRDDIDEMSAGNASVLTTVLKLIDKYDLYGSVAFPKHHKQSDVPEIYRLTGKMKGVFIN
PALVEPFGLTLIEAAAHGLPIVATKNGGPVDIKNALNNGLLVDPHDQHAIADALLKLVAD
KNLWQECRKNGLRNIQLYSWPEHCRTYLTRIAGCRIRNPRWLMDTPADAAAEEEEALEDS
LMDVQDLSLRLSIDGERGSSMNDAPSSDPQDSVQRIMNKIKRSSPADTDGAKIPAEAAAT
ATSGAMNKYPLLRRRRRLFVIAVDCYGDDGSASKRMLQVIQEVFRAVRSDSQMSRISGFA
LSTAMPLPETLKLLQLGKIPPTDFDALICGSGSEVYYPSTAQCVDAGGRLRPDQDYLLHI
NHRWSHDGAKQTIAKLAHDGSGTNVEPDVESCNPHCVSFFIKDPNKVRTIDEMRERVRMR
GLRCHLMYCRNATRLQVVPLLASRSQALRYLFVRWGLSVGNMYLIVGEHGDTDHEEMLSG
LHKTVIIRGVTEKGSEQLVRSSGSYQREDVVPSESPLIAFTKGDLKADEIMRALKEVTKA
ASGM
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggcggggaacgagtggatcaatggctacctggaggcgatactggacagcggcggcgcg
gcggggggaggtggaggcggcggaggaggtggtggtggaggtggaggtggcggtggaggt
ggagggggagggggagtcgacccgaggtcgccggcggcgggggcggcgagcccgcgtggc
ccgcacatgaacttcaatccgacgcactacttcgtggaggaggtggtgaagggcgtcgac
gagagcgacctccaccggacgtggatcaaggtcgtcgccacccgcaacgcccgcgagcgg
agcacccgcctcgagaacatgtgctggcgcatctggcacctcgcgagaaagaagaagcag
ctggagcttgagggaatcctgaggatttctgcacggaggaaggagcaggagcaggtgcgc
cgcgagacttcggaggaccttgcagaggatctgtttgaaggcgagaaggcggacaccgtc
ggtgaattggcacagcaagacactcccatgaagaagaagttccagaggaacttctcagag
ctcaccgtcagctggtccgacgagaacaaggagaaaaagctgtacattgtgctcatcagt
cttcatggtctagttcgtggcgataacatggaacttggtcgggattcagatactggagga
caggtgaaatatgttgttgaactcgcaagagcacttgcaatgatgcctggcgtgtacaga
gtggatctgtttactcgtcaagtgtcatctcctgaagtggactggagctatggggagcct
actgaaatgttaacctccggttccactgacggagagggaagcggtgagagtgctggtgcg
tacattgtgcgcattccgtgcggtccaagggacaagtacctccgtaaagaggccctgtgg
ccttacctccaagagtttgtcgacggagctctcgcgcatatcctgaacatgtccaaggct
ctgggggaacaggttagcaatgggaagctggtcttgccatatgtaatccatggccactat
gccgatgctggagatgtcgctgctcttctttctggtgcgctgaatgtgccgatggttctc
accggtcattcacttgggaggaacaagctggagcagatcatgaagcaagggcgcatgtcg
aaggaggagattgactcaacttacaagatcatgaggcgcattgagggtgaggagctggcc
ttggatgcagcggagcttgtcataacgagtacaaggcaggagattgatgagcaatgggga
ctgtatgatggctttgatgtcaagctagagaaagttttgagggctcgtgcgaggcgcgga
gttagctgccacggccgttttatgcctagaatggtggtaattcctcctgggatggatttc
agcagtgttgtggttcctgaagataccagcgatggagatgatggcaaagactttgagatt
gcctcgccgaggtcactgcccccaatctgggctgaggtgatgcggtttttgaccaatccc
cacaagccaatgattctggctctgtcaagacctgatccaaagaagaacatcaccaccctt
gtcaaagcatttggagaatgtcgcccactgagggaacttgcaaacctaattctgatcatg
gggaacagggatgacatcgatgagatgtccgctggcaatgcaagcgtcctcaccactgtc
ctgaagctgatcgacaagtatgatctgtacggaagtgttgcattccccaagcatcacaag
cagtcagacgtaccggagatttatcgcctcacagggaagatgaagggcgtcttcatcaat
cctgctcttgttgagcctttcggtctcaccctgatcgaggctgcggctcacggtctcccg
atcgtcgccaccaagaacggcggtccggttgacattaaaaatgctctgaacaatggactg
ctggtagacccgcatgaccagcacgccattgccgacgcgctgctgaagctggtggcggac
aagaacctgtggcaggagtgccggaagaacggcctgcgcaacatccagctctactcgtgg
ccggagcattgccggacatacctcaccaggatagccggatgccggatcaggaacccgcgc
tggctgatggacacgccggcggacgcggccgccgaggaggaggaagccctggaggactcg
ctcatggacgtccaggacctctcgctgcgcctgtccatcgacggcgagcgggggtcatcc
atgaacgacgcgccatcgtcggacccgcaggactcggtgcagaggatcatgaacaagatc
aagcggtcgtctcccgcggacacggacggcgccaagattccggccgaagcggccgccacc
gccacctccggtgccatgaacaagtacccgctcctccgccgacgccgcaggctgttcgtc
atagccgtggactgctacggcgacgatggcagcgccagcaagaggatgctgcaggtgatc
caggaggtgttcagggctgtccggtcggactcccagatgtccaggatctccgggttcgcg
ctgtcgacggcgatgccgctgccggagacgctcaagcttctgcagctgggcaagatccca
ccgaccgacttcgacgcgctcatctgcggcagcggcagcgaggtgtactaccccagcacg
gcgcagtgtgtggacgccggggggaggctgcgccccgaccaggactacctgctgcacatc
aaccaccggtggtctcacgacggcgccaagcagaccattgccaagctcgcgcacgacgga
tccggcaccaatgtcgaaccggacgtggagtcctgcaacccccactgtgtctccttcttc
atcaaagaccccaataaggtgaggacgatcgatgagatgcgggagagggtgaggatgcgt
ggcctccgatgccatctcatgtactgcaggaatgcaacaaggcttcaagttgttcctctt
ctagcatcgaggtcacaagcactcaggtatcttttcgtacgctggggcctgtctgtggga
aacatgtatctgatcgtcggggagcacggcgacaccgatcacgaggagatgctgtcaggg
ttacacaagacggtgatcatccgcggcgtcaccgagaagggctcggagcagctggtgagg
agctcagggagttaccagagggaagatgttgtcccatccgagagccccttgattgctttc
acaaagggtgatctgaaggccgatgagatcatgcgtgctctcaaggaggtcaccaaggct
gccagtggcatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328527
Entry
4328527           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphate synthase 2 isoform X1
  KO
K00696  sucrose-phosphate synthase [EC:2.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4328527
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.14  sucrose-phosphate synthase
     4328527
SSDB
Motif
Pfam: Glycos_transf_1 Sucrose_synth S6PP Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 DUF1752 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4328527
NCBI-ProteinID: XP_015626343
UniProt: B7F7B9 A0A0P0VFT3
LinkDB
Position
2:4708492..4716285
AA seq 1011 aa
MLRHFSALAPSPLLFLLFLPFPWLRLHSSAHSSPPPRSRRDLHGGGGGMAGNDNWINSYL
DAILDAGKAAIGGDRPSLLLRERGHFSPARYFVEEVITGYDETDLYKTWLRANAMRSPQE
RNTRLENMTWRIWNLARKKKEFEKEEACRLLKRQPEAEKLRTDTNADMSEDLFEGEKGED
AGDPSVAYGDSTTGSSPKTSSIDKLYIVLISLHGLVRGENMELGRDSDTGGQVKYVVELA
KALSSSPGVYRVDLLTRQILAPNFDRSYGEPTEMLVSTSFKNSKQEKGENSGAYIIRIPF
GPKDKYLAKEHLWPFIQEFVDGALGHIVRMSKTIGEEIGCGHPVWPAVIHGHYASAGIAA
ALLSGSLNIPMAFTGHFLGKDKLEGLLKQGRHSREQINMTYKIMCRIEAEELSLDASEIV
IASTRQEIEEQWNLYDGFEVILARKLRARVKRGANCYGRYMPRMVIIPPGVEFGHIIHDF
EMDGEEENPCPASEDPPIWSQIMRFFTNPRKPMILAVARPYPEKNITSLVKAFGECRPLR
ELANLTLIMGNREAISKMNNMSAAVLTSVLTLIDEYDLYGQVAYPKHHKHSEVPDIYRLA
ARTKGAFVNVAYFEQFGVTLIEAAMNGLPIIATKNGAPVEINQVLNNGLLVDPHDQNAIA
DALYKLLSDKQLWSRCRENGLKNIHQFSWPEHCKNYLSRILTLGPRSPAIGGKQEQKAPI
SGRKHIIVISVDSVNKEDLVRIIRNTIEVTRTEKMSGSTGFVLSTSLTISEIRSLLVSAG
MLPTVFDAFICNSGSNIYYPLYSGDTPSSSQVTPAIDQNHQAHIEYRWGGEGLRKYLVKW
ATSVVERKGRIERQIIFEDPEHSSTYCLAFRVVNPNHLPPLKELRKLMRIQSLRCNALYN
HSATRLSVVPIHASRSQALRYLCIRWGIELPNVAVLVGESGDSDYEELLGGLHRTVILKG
EFNIPANRIHTVRRYPLQDVVALDSSNIIGIEGYSTDDMKSALQQIGVLTQ
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgcttcgccatttctccgcacttgctccttctcctctccttttcctcctcttccttccc
ttcccttggcttcgcctccactcctccgctcactcctctccccctccacgatctcgccgg
gatctccacggcggcggcggcggcatggcgggcaacgacaactggataaacagttacctc
gacgccatcctcgacgccggcaaggcggcaatcggcggcgaccgcccctcgctcctcctc
cgggagcgcggccacttctccccggcgcgctacttcgtcgaggaggtcatcaccgggtac
gacgagaccgacctctacaagacatggctccgcgcgaacgcgatgcggagcccgcaggag
aggaacacgcggctggagaacatgacgtggaggatctggaacctcgcgaggaagaagaag
gagttcgagaaagaagaagcctgtcgtctgttgaaacgccaaccagaagctgagaaatta
cgaactgatactaatgcagatatgtctgaagatctatttgaaggagaaaagggagaagat
gctggtgatccctcagttgcgtatggtgacagcaccacagggagctcacctaagacgagt
tcaattgacaagctatacatagtactgataagcctacatggtctggtccgtggtgagaac
atggagctaggacgagattcagatactggtggccaggtcaaatatgtggttgaacttgct
aaagcgttgagttcatctcctggagtttacagggttgatttgctgacaagacaaatcttg
gcaccaaatttcgatcgtagttatggtgaacctacagaaatgttggtttcaacaagcttt
aaaaattctaaacaggaaaagggtgagaacagtggtgcatacatcattcggataccattt
ggaccaaaagacaaatacctagctaaagaacatctatggcctttcattcaagaatttgtt
gatggtgcacttggccatatcgtgcggatgtcaaaaaccattggtgaagaaattggctgt
gggcatccagtatggcctgctgtgattcatggacactatgccagtgcaggaatagctgct
gctctgttgtctgggtctcttaatattcctatggcatttacaggccattttcttggtaag
gacaaattggaagggcttctcaagcaagggcgacattcaagggaacaaataaatatgaca
tacaaaataatgtgccgaattgaggcagaggaattatctcttgatgcatctgaaattgtt
attgctagcactagacaggagatagaagagcagtggaacttgtatgatggttttgaggtt
atacttgcaaggaagcttcgggcaagagttaagcgtggtgctaactgctatggccgttat
atgcctcgtatggttataatacctcctggtgttgaatttggtcatatcattcacgatttt
gaaatggatggtgaagaagaaaatccatgtccagcctctgaggacccacccatttggtct
cagataatgcgcttctttacaaatcctaggaagcctatgattctggctgttgctcgtcca
tatcctgaaaagaatattacatcacttgtaaaggcatttggtgaatgtcgccctctaagg
gagctagcaaatctgacactgataatgggtaaccgtgaggccatttctaagatgaacaac
atgagtgctgctgtcttgacctcagtgcttacattgattgatgaatatgacttgtatggt
caagtggcttatcccaagcatcataagcactctgaagttccagacatttatcgtttagct
gccaggacaaagggtgcttttgtgaatgtggcttattttgaacaatttggtgttacccta
atagaggctgctatgaatggtttgcctattattgcaacaaaaaatggagctcctgtagaa
attaatcaggtgctgaacaatggtctccttgttgatccacatgatcagaatgccattgca
gatgcactgtataagcttctttctgacaaacaactttggtcgagatgtagagagaatggg
ctaaaaaatattcaccagttctcatggcctgaacattgcaagaattacttgtcaaggata
ttgacacttggtccgagatcacctgctattggtggcaaacaggaacagaaggcacccata
tcaggaaggaagcatatcattgttatatctgtagactctgttaacaaggaagatctagtc
cggataatcagaaacactattgaagtcacacgcacagaaaaaatgtctggttcaactggt
tttgtgctgtcaacttcacttacaatatcagagatacgctcgctgctagtgtctgcaggc
atgttgcctactgtttttgatgctttcatctgcaatagtggaagtaatatctattatcct
ttgtattcgggagatacgccaagcagttcccaggttactcctgcaatagatcaaaatcac
caagcacatattgagtatcgatggggaggagaaggcctaagaaagtatctagtgaaatgg
gctacttcagtggtagaaagaaagggaagaatcgaaagacaaattatttttgaagaccct
gaacactcttcaacctattgtcttgcatttagagtggtcaatccaaatcatctaccccct
ttaaaggagttgaggaaattgatgagaatccaatcactccgttgcaatgccttgtataac
cacagtgccaccagactctctgtagttcccattcacgcatcacgttcccaggcactaagg
tacttgtgtatacgctggggaatagagctgccaaatgttgcagtccttgttggtgaaagt
ggcgattcggattatgaagaactgctaggtggtctccacaggaccgtcatcctgaagggc
gagttcaacatccccgcgaacagaatccatactgtcaggagatatccgttacaagatgtc
gtcgccctggacagctcaaatatcattggcattgagggttacagtacagatgacatgaag
tcagctctgcagcagattggtgtgctgacacaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341642
Entry
4341642           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphate synthase 3 isoform X5
  KO
K00696  sucrose-phosphate synthase [EC:2.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4341642
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.14  sucrose-phosphate synthase
     4341642
SSDB
Motif
Pfam: Glycos_transf_1 Sucrose_synth Glyco_trans_1_4 S6PP Glyco_transf_4 Glyco_trans_4_4 DUF1752 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4341642
NCBI-ProteinID: XP_015643380
UniProt: Q67WN8
LinkDB
Position
6:complement(26241947..26250408)
AA seq 977 aa
MYGNDNWINSYLDAILDAGKGAAASASASAVGGGGGAGDRPSLLLRERGHFSPARYFVEE
VITGYDETDLYKTWLRANAMRSPQEKNTRLENMTWRIWNLARKKKELEKEEANRLLKRRL
ETERPRVETTSDMSEDLFEGEKGEDAGDPSVAYGDSTTGNTPRISSVDKLYIVLISLHGL
VRGENMELGRDSDTGGQVKYVVELAKALSSCPGVYRVDLFTRQILAPNFDRSYGEPVEPL
ASTSFKNFKQERGENSGAYIIRIPFGPKDKYLAKEHLWPFIQEFVDGALSHIVKMSRAIG
EEISCGHPAWPAVIHGHYASAGVAAALLSGALNVPMVFTGHFLGKDKLEELLKQGRQTRE
QINMTYKIMCRIEAEELALDASEIVIASTRQEIEEQWNLYDGFEVILARKLRARVKRGAN
CYGRYMPRMVIIPPGVEFGHMIHDFDMDGEEDGPSPASEDPSIWSEIMRFFTNPRKPMIL
AVARPYPEKNITTLVKAFGECRPLRELANLTLIMGNREAISKMHNMSAAVLTSVLTLIDE
YDLYGQVAYPKRHKHSEVPDIYRLAVRTKGAFVNVPYFEQFGVTLIEAAMHGLPVIATKN
GAPVEIHQVLDNGLLVDPHDQHAIADALYKLLSEKQLWSKCRENGLKNIHQFSWPEHCKN
YLSRISTLGPRHPAFASNEDRIKAPIKGRKHVTVIAVDSVSKEDLIRIVRNSIEAARKEN
LSGSTGFVLSTSLTIGEIHSLLMSAGMLPTDFDAFICNSGSDLYYPSCTGDTPSNSRVTF
ALDRSYQSHIEYHWGGEGLRKYLVKWASSVVERRGRIEKQVIFEDPEHSSTYCLAFKVVN
PNHLPPLKELQKLMRIQSLRCHALYNHGATRLSVIPIHASRSKALRYLSVRWGIELQNVV
VLVGETGDSDYEELFGGLHKTVILKGEFNTSANRIHSVRRYPLQDVVALDSPNIIGIEGY
GTDDMRSALKQLDIRAQ
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgtacggcaacgacaactggatcaacagctacctggatgccatcctcgacgccggcaag
ggcgccgccgcctcggcctcggcctcggcggtgggtgggggaggcggagcgggggaccgc
ccctcgctcctcctccgcgagcgcggccacttctcccccgcgcggtacttcgtcgaggag
gtcatcaccggctacgacgagaccgacctctacaagacatggctccgcgcgaacgcgatg
cggagcccgcaggagaagaacacgaggctggagaacatgacgtggaggatctggaacctc
gccaggaagaagaaggagttggagaaggaggaagccaatcgcttgttgaaacgccgtcta
gagacagagaggccacgggttgagactacttcagatatgtcggaagatctctttgaaggt
gagaagggagaggatgctggtgatccttctgttgcctatggtgacagcacaactgggaac
acacctaggatcagttcagttgacaagctgtacatagtgttgatcagccttcatggcctg
gtccgtggtgagaacatggagcttggccgtgattcagatactggcggacaggtcaagtat
gttgtggaacttgctaaagcattgagctcatgtcctggagtttaccgggttgatcttttt
acaagacagatcttagcgccaaattttgatcgtagctatggtgaaccagtggaacctttg
gcatcaacaagcttcaagaattttaagcaggaaagaggagagaatagtggtgcatatatc
atccgaataccatttggaccaaaagacaaatatctagctaaggaacatctctggcctttc
attcaagaatttgttgatggcgccctcagtcatatagtgaagatgtcaagggccataggt
gaagaaatcagctgtgggcatccggcgtggcctgctgtgattcatggtcattatgctagt
gcaggagttgctgctgctctactgtcaggagcacttaatgttcccatggtctttacaggg
cattttcttgggaaagataagttggaagagcttctcaagcaagggagacagacaagggag
caaataaacatgacatacaaaataatgtgtagaattgaggcagaggagttggctcttgat
gcatctgaaatagttatagcaagcactaggcaagagatagaagagcaatggaatttgtat
gacggttttgaggtcatacttgcaaggaaactccgtgcaagagtcaagcgtggtgctaac
tgctatggtcgctatatgcctcgtatggttatcattcccccaggtgttgaatttggccat
atgattcatgacttcgatatggatggtgaggaagacggtccatccccagcctctgaagat
ccatctatttggtccgagataatgcggttctttacaaaccctaggaaacctatgattctg
gcagttgctcgcccttatcctgaaaagaatattactactcttgtgaaggcgtttggtgag
tgccgaccactgagggagcttgctaatctaacattgataatgggaaaccgtgaggctatt
tccaagatgcataatatgagtgcagctgttttgacatcagtacttacattgattgatgaa
tatgatttgtatggtcaagtggcatacccaaagcgtcacaaacactcggaagttcctgat
atttaccgtttagcagtgagaacaaagggtgcttttgtaaatgtgccttactttgaacag
ttcggtgtcaccttgatagaggctgccatgcatggtttgcctgtaattgcaacaaaaaat
ggagctcctgttgaaattcaccaggtgctggacaatggtctccttgttgatccccatgat
cagcatgcaattgcagatgcactctataaactcctttctgaaaaacaactttggtcaaaa
tgccgagagaatgggctgaaaaatatacatcagttttcttggcctgaacattgcaagaat
tacttgtcaaggatatcaactcttggcccaaggcatcctgcttttgcaagcaatgaagac
cggattaaggcacctattaagggaaggaagcatgtcactgttattgctgtagattctgtc
agtaaggaagatctgattcgcattgtcagaaattctatcgaggctgcacgtaaagaaaat
ttgtcaggatcgacaggttttgtgttgtcaacttccctgacaataggggagatacattct
ctattaatgtctgctggcatgcttcctactgatttcgatgctttcatatgcaatagtgga
agtgatttgtattatccttcatgtactggtgatacaccaagcaactcccgtgttacattt
gcattagatcgtagttaccaatcacatatagagtatcattggggaggagaaggtttaagg
aaatatctagtgaagtgggcttcttccgtggtagaaagaagagggaggattgaaaaacaa
gttatcttcgaagatccagagcactcttcaacatactgtcttgcatttaaagtggtcaat
ccaaatcatttacctcctttaaaggagctgcaaaagttgatgagaattcagtcactccgt
tgtcacgctctgtataaccatggtgctaccagactatctgtaattccaatccacgcatca
cggtctaaggctctaaggtacttatctgttcgctggggcatagagttgcaaaatgtggtg
gttcttgttggtgaaactggtgattcagattacgaagaattgtttggaggtcttcataag
acggtcatccttaagggtgaattcaacacatctgcaaatagaatccattctgttaggcgg
tatcctttacaagatgttgttgcacttgatagcccaaacatcattggaattgagggttat
ggcactgatgacatgaggtctgctctgaaacaactggatatacgggcacagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345220
Entry
4345220           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphate synthase 4
  KO
K00696  sucrose-phosphate synthase [EC:2.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4345220
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.14  sucrose-phosphate synthase
     4345220
SSDB
Motif
Pfam: Glycos_transf_1 S6PP Glyco_trans_1_4 Sucrose_synth Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2 DUF1752
Other DBs
NCBI-GeneID: 4345220
NCBI-ProteinID: XP_015650062
UniProt: Q6ZHZ1
LinkDB
Position
8:12411919..12424693
AA seq 1066 aa
MAGNDWINSYLEAILDAGGAAGEISAAAGGGGDGAAATGEKRDKSSLMLRERGRFSPARY
FVEEVISGFDETDLYKTWVRTAAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLA
KQRLEREKARRYAAADMSEDLSEGEKGENINESSSTHDESTRGRMPRIGSTDAIEAWASQ
HKDKKLYIVLISIHGLIRGENMELGRDSDTGGQVKYVVELARALGSTPGVYRVDLLTRQI
SAPDVDWSYGEPTEMLSPRNSENFGHDMGESSGAYIVRIPFGPRDKYIPKEHLWPHIQEF
VDGALVHIMQMSKVLGEQVGSGQLVWPVVIHGHYADAGDSAALLSGALNVPMIFTGHSLG
RDKLEQLLKQGRQTRDEINTIYKIMRRIEAEELCLDASEIIITSTRQEIEQQWGLYDGFD
LTMARKLRARIKRGVSCYGRYMPRMIAVPPGMEFSHIVPHDVDQDGEEANEDGSGSTDPP
IWADIMRFFSNPRKPMILALARPDPKKNITTLVKAFGEHRELRNLANLTLIMGNRDVIDE
MSSTNSAVLTSILKLIDKYDLYGQVAYPKHHKQSEVPDIYRLAARTKGVFINCAFIEPFG
LTLIEAAAYGLPMVATRNGGPVDIHRVLDNGILVDPHNQNEIAEALYKLVSDKQLWAQCR
QNGLKNIHQFSWPEHCKNYLSRVGTLKPRHPRWQKSDDATEVSEADSPGDSLRDVHDISL
NLKLSLDSEKSSTKENSVRRNLEDAVQKLSRGVSANRKTESVENMEATTGNKWPSLRRRK
HIVVIAIDSVQDANLVEIIKNIFVASSNERLSGSVGFVLSTSRAISEVHSLLTSGGIEAT
DFDAFICNSGSDLCYPSSNSEDMLSPAELPFMIDLDYHTQIEYRWGGEGLRKTLICWAAE
KSEGGQVVLVEDEECSSTYCISFRVKNAEAVPPVKELRKTMRIQALRCHVLYSHDGSKLN
VIPVLASRSQALRYLYIRWGVELSNMTVVVGESGDTDYEGLLGGVHKTIILKGSFNAVPN
QVHAARSYSLQDVISFDKPGITSIEGYGPDNLKSALQQFGILKDNV
NT seq 3201 nt   +upstreamnt  +downstreamnt
atggcggggaacgactggatcaacagctacctggaggcgatcctcgacgcgggcggggcc
gcgggggagatctccgccgcggcggggggaggtggagatggagcggcggccaccggggag
aagcgggacaagtcgtcgctgatgctccgggagcggggccggttcagccccgcgcgctac
ttcgtcgaggaggtcatctccgggttcgacgagaccgacctctacaagacctgggtccgc
acggcggcgatgaggagcccgcaggagaggaacacgcggctggagaacatgtcgtggagg
atctggaaccttgccagaaagaagaagcagattgaaggtgaagaagcctcccgtttagct
aaacaacgtcttgagcgtgagaaggctcgtagatatgctgctgccgatatgtctgaagac
ctatctgagggtgaaaagggagaaaacattaatgaatcatcatctactcatgacgagagc
acaagggggagaatgcctaggataggttcaacagatgctattgaggcatgggcaagtcag
cacaaggataaaaagctatacattgttctgataagcattcatggtcttatacgtggtgaa
aatatggagcttgggcgtgattcagacactggtggtcaggtcaaatatgttgtagaactt
gctcgggcattaggttcaacacctggagtatatagggttgatcttctgacaaggcagatt
tctgcacctgatgttgattggagttatggggaacctacagagatgctgagtccaagaaat
tcagagaattttgggcatgatatgggtgaaagcagtggtgcttatattgtgaggatacct
tttggaccaagagataaatatatccccaaagagcatctctggccccacatccaggaattt
gttgacggtgcacttgtccatatcatgcagatgtccaaggttcttggagaacaagttggc
agtggacagctagtatggcctgttgttatccatggacactatgccgatgcaggtgactct
gctgctttgctatctggggcactcaatgtcccaatgatattcacaggtcattctcttggc
agagacaagttggagcaacttttgaagcaagggcgtcaaaccagggatgaaataaataca
atatacaagataatgcgtcgaattgaggctgaggaactttgtcttgatgcatctgaaatc
ataattacaagcactagacaagagatagaacaacaatggggattatatgatggttttgat
ttaaccatggcaaggaaacttagagcaagaataaagcgtggtgtgagctgctacggtcgc
tacatgcctcgtatgattgcagttcctcctggcatggagtttagccatatagtgcctcat
gatgttgatcaggatggtgaagaagctaatgaagatggttcaggttcaacagatccacct
atttgggctgatataatgcgattcttctccaaccctcgcaagcccatgattctagctctt
gctcgtccagatcctaagaagaacatcactacactggtcaaggcatttggtgaacatcgt
gaattgagaaatttagcaaaccttacacttatcatgggtaaccgtgatgttattgatgaa
atgtcaagcacaaattcagctgttttgacatcaatactcaagttaattgacaagtatgat
ctatatggccaagtggcataccccaagcaccataagcaatctgaagttccagatatttat
cgtttagcggcaagaacaaagggggtgtttatcaattgtgcttttatcgagccatttgga
ctaaccttgattgaggctgctgcttatggtctaccaatggttgctactcgaaatggtggg
cccgttgatatacatcgggttcttgacaatggtattctcgttgatccccacaatcaaaat
gaaatagctgaggcactttataagcttgtttctgataagcagttgtgggcacagtgccgc
caaaatggtctgaaaaatattcatcaattttcttggcctgaacattgcaaaaactatttg
tcacgggttggtacactcaagccacgacatcctcgatggcaaaagagtgatgatgctact
gaagtttccgaagctgactcacctggagattccttgagggatgttcatgatatatctctt
aacttgaagctttccttggacagtgagaaatcaagcacaaaggaaaatagtgtaagaaga
aaccttgaggatgctgtacaaaagttgtcaagaggtgttagtgccaacagaaagacagag
tctgttgagaatatggaggctaccacaggcaataaatggccatctttgcgaagaaggaaa
cacattgtagtcattgctatagattctgtgcaagatgctaacctggttgagattatcaaa
aatatttttgtggcttcaagcaatgagagattatctggttctgttggttttgttttgtca
acatcccgagcaatatcagaggtacattctttgctaacatctgggggcatagaagctact
gattttgatgccttcatatgcaacagtggtagcgatctttgctatccatcctcaaattct
gaagacatgcttagccctgcagagctcccatttatgattgatcttgattatcacactcaa
attgagtaccgttggggtggagaaggtttaaggaagacactaatttgttgggcagcagaa
aaaagcgagggtggtcaagtggtacttgtagaagatgaagaatgttcatccacttattgt
atttcatttagagtgaagaatgctgaggctgtacctcctgtgaaagagcttaggaagaca
atgagaattcaagcactgcgctgtcatgttttgtacagtcatgatggtagcaagttgaat
gttattcctgttttagcatcacgatcgcaggctctaaggtacttgtatataagatggggg
gtagagctgtcaaatatgacagtggttgttggtgaaagtggtgatactgattatgaagga
ctattaggaggcgtgcacaagaccattattctcaaaggctcatttaatgctgttcctaac
caagtccatgctgccagaagttattcattacaggatgtcatatcctttgacaaaccagga
attacttcaatcgagggatatggtccagataaccttaagtcagctctacaacaatttggt
atactgaaagacaatgtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350151
Entry
4350151           CDS       T01015                                 
Name
(RefSeq) probable sucrose-phosphate synthase 5 isoform X2
  KO
K00696  sucrose-phosphate synthase [EC:2.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4350151
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.14  sucrose-phosphate synthase
     4350151
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 S6PP Sucrose_synth Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4350151
NCBI-ProteinID: XP_015617675
UniProt: Q53JI9
LinkDB
Position
11:complement(7255802..7263167)
AA seq 1014 aa
MVHHYSMSCPDLEAIEQVEWEFSRQLSRRRLEQELGSREAAADLSELSEGEKDGKPDTHP
PPAAAAAEAAADDGGGGDHQQQQQQPPPHQLSRFARINSDPRIVSDEEEEVTTDRNLYIV
LISIHGLVRGENMELGRDSDTGGQVKYVVELARALAATPGVHRVDLLTRQISCPDVDWTY
GEPVEMLTVPAADADDEDGGGGSSGGAYIVRLPCGPRDKYLPKESLWPHIPEFVDRALAH
VTNVARALGEQLSPPPPSDGAGAAAQAVWPYVIHGHYADAAEVAALLASALNVPMVMTGH
SLGRNKLEQLLKLGRMPRAEIQGTYKIARRIEAEETGLDAADMVVTSTKQEIEEQWGLYD
GFDLKVERKLRVRRRRGVSCLGRYMPRMVVIPPGMDFSYVDTQDLAADGAGGAGDAADLQ
LLINPNKAKKPLPPIWSEVLRFFTNPHKPMILALSRPDPKKNVTTLLKAYGESRHLRELA
NLTLILGNRDDIEEMSGGAATVLTAVLKLIDRYDLYGQVAYPKHHKQTDVPHIYRLAAKT
KGVFINPALVEPFGLTIIEAAAYGLPVVATKNGGPVDILKVLSNGLLVDPHDAAAITAAL
LSLLADKSRWSECRRSGLRNIHRFSWPHHCRLYLSHVAASCDHPAPHQLLRVPPSPSSSS
AAAAAAGGGGAAASSEPLSDSLRDLSLRISVDAASPDLSAGDSAAAILDALRRRRSTDRP
AASSAARAIGFAPGRRQSLLVVAIDCYGDDGKPNVEQLKKVVELAMSAGDGDDAGGRGYV
LSTGMTIPEAVDALRACGADPAGFDALICSSGAEICYPWKGEQLAADEEYAGHVAFRWPG
DHVRSAVPRLGKADGAQEADLAVDAAACSVHCHAYAAKDASKVKKVDWIRQALRMRGFRC
NLVYTRACTRLNVVPLSASRPRALRYLSIQWGIDLSKVAVLVGEKGDTDRERLLPGLHRT
VILPGMVAAGSEELLRDEDGFTTEDVVAMDSPNIVTLADGQDIAAAAADLLKAI
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggttcaccattatagcatgagttgtccagatctcgaagcgatcgaacaggtggagtgg
gaattctcgcgacagctgtctcgccggcggctggagcaggagcttggcagccgggaggcc
gccgccgacctctcggagctctccgagggtgagaaggacggcaagccggacactcaccct
ccaccggcggcggcggcggcggaagcggcggccgacgacggcggcggcggcgatcaccag
cagcagcagcagcagccgccgccgcatcagctcagccggttcgcccggatcaactccgac
ccccggatcgtctccgacgaggaggaggaggtcaccaccgaccggaacctctacatcgtg
ctcatcagcattcatgggctcgtgcggggcgagaacatggagctcggccgagactctgac
accgggggccaggtgaagtacgtggtggagttggcgcgggcgctggcggcgacgccgggg
gtgcaccgcgtcgacctcctgacgcggcagatctcgtgcccggacgtcgactggacctac
ggcgagcccgtcgagatgctcaccgtcccggctgccgacgccgacgacgaagacggcggc
ggcggctcgtccggcggcgcgtacatcgtgcggctgccgtgcgggccgcgcgacaagtac
ctccccaaggagtcgctctggccgcacatcccggagttcgtcgaccgcgctctggcgcac
gtcaccaacgtggcgcgcgcgctcggcgagcagctctcgccgccgccgccgtccgatggc
gcgggcgcggcggcgcaggcggtgtggccgtacgtgatccacgggcactacgcggacgcg
gcggaggtggcggcgctgctggcgagcgcgctgaacgtgccgatggtgatgacggggcac
tcgctggggcggaacaagctggagcagctgctgaagctggggcgcatgccgcgcgccgag
atccagggcacgtacaagatcgcgcggcggatagaggcggaggagaccggcctcgacgcc
gccgacatggtggtgacgagcaccaagcaggagatcgaggagcagtgggggctctacgac
gggttcgacctcaaggtggagcgcaagctccgcgtccgccgccgccgcggcgtcagctgc
ctcggccgctacatgccgcgcatggtcgtcatcccccccggcatggacttcagctacgtc
gacacccaggacctcgctgccgacggcgccggcggcgccggcgacgccgccgacctgcag
ctgctcatcaaccccaacaaggccaagaagcccctccctcccatctggtcggaggtgctc
cggttcttcacgaacccgcacaagcccatgatcctcgcgctgtcgcggccggacccgaag
aagaacgtcaccacgctgctcaaggcgtacggcgagagccgccatctccgggagctcgcc
aacctgacgctgatactggggaacagggacgacatcgaggagatgtccggcggcgcggcg
acggtgctgacggcggtgctgaagctgatcgaccggtacgacctctacggccaggtcgcc
taccccaagcaccacaagcagaccgacgtgccgcacatctaccgcctcgccgccaagacc
aagggtgtgttcatcaatcctgctcttgtcgagccattcggcctcaccatcatagaggct
gctgcatatgggttgccggtagtggcgacgaagaacggcgggccggtggacatcctcaag
gtgctgagcaacgggctgctggtggacccgcacgacgcggcggcgatcaccgccgcgctg
ctcagcctgctcgccgacaagtcccggtggtcggagtgccgccgcagcggcctccgcaac
atccaccgcttctcctggccgcaccactgccgcctctacctctcccacgtcgccgccagc
tgcgaccacccggcgccgcaccagctgctccgcgtcccgccctccccgtcctcctcatcc
gccgccgccgccgccgccggtggcggcggcgcggccgcctcctccgagccgctctccgac
tcgctgcgcgatctctcgctccgcatctccgtggacgccgcgtcgcctgacctcagcgct
ggggactccgccgcggcaatcttggacgcgctccgcaggcgccggtccacggacaggccg
gcggcgagctctgccgccagggcgatcgggttcgcgccgggacggcgtcagagcctcctc
gtcgtcgccatcgactgctacggcgacgacgggaagccgaacgtggagcagctcaagaag
gtggtcgagctggcgatgtcggccggcgacggcgacgacgccggcgggaggggatacgtt
ctttccaccggcatgaccatccccgaggccgtcgacgcgctcagggcatgcggcgccgac
ccggccggcttcgacgcgctgatctgcagcagcggcgcggagatctgctacccgtggaag
ggggagcagctcgccgccgacgaggagtacgccgggcacgtggcgttccggtggcccggc
gaccacgtgaggtccgcggtgccgaggctcgggaaggccgacggcgcgcaggaggcggac
ctcgccgtcgacgccgccgcctgctccgtgcactgccacgcctacgccgccaaggacgcg
tccaaggtgaagaaggtcgactggatcaggcaggcgctgcggatgcgcggcttccggtgc
aacctcgtctacacgcgcgcgtgcacgcgcctcaacgtcgtcccgctctccgcctcccgg
ccgcgcgcgctcaggtacctgtcgatacagtgggggatcgacctgtccaaggtggcggtg
ctcgtcggcgagaagggcgacaccgacagggagcgcctcctcccggggctgcacaggacg
gtgatcctgccggggatggtcgccgccggcagcgaggagctcctccgcgacgaggacggg
ttcaccacggaggacgtcgtggccatggactcccccaacatcgtcaccctcgccgacggc
caggacatcgccgccgccgccgccgacctcctcaaggccatctga

DBGET integrated database retrieval system