KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324379
Entry
4324379           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 14 homolog
  KO
K03030  26S proteasome regulatory subunit N11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4324379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4324379
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324379
   03051 Proteasome [BR:osa03051]
    4324379
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4324379
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4324379
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4324379
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF5352
Other DBs
NCBI-GeneID: 4324379
NCBI-ProteinID: XP_015622144
UniProt: Q9SDD1 A0A8J8YS49
LinkDB
Position
1:9166346..9169857
AA seq 307 aa
MERLQRIFGASGMGQPPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFV
DDYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWL
SGVDINTQQSFEALNPRAVAVVIDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVG
HLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLILKSFDTHSKTNE
QTVQEMLNLAIKYNKAVQEEDELPPEKLAIANVGRQDAKKHLEEHVSNLMSSNIVQTLGT
MLDTVVF
NT seq 924 nt   +upstreamnt  +downstreamnt
atggagcggctgcagcggatcttcggggcgtcggggatggggcagccgccgacggactcg
ccgctgctcgactcctccgagcaggtctacatctcctccctcgccctcctcaagatgctc
aagcacgggcgggccggcgtgccgatggaggtgatggggctgatgctcggggagttcgtc
gacgactacaccgtcagggtggtcgacgtcttcgccatgccgcagagcgggacgggcgtc
agcgtcgaggccgtcgaccacgtcttccagaccaacatgctcgacatgctcaagcagacc
gggagaccagaaatggtggtgggctggtatcactcccatcctggatttggatgttggctt
tcaggtgttgatatcaacactcagcagagttttgaagctttaaatcccagggctgttgca
gttgtgatagacccaatccagagtgtcaaggggaaggtggtcattgatgcatttcgtctc
attaatcctcagaccatgatgcttggccaggaaccgcgacagacaacatcaaatgttggg
catctaaacaaaccatctatccaggctcttattcacgggctgaacagacactactactcc
attgcaatcaattaccgcaaaaatgaactggaggagaaaatgttgcttaacttacacaaa
aagaaatggaccgatggattgattttgaagagttttgacactcattcgaaaaccaatgag
cagactgttcaggaaatgctgaacctagccatcaaatataacaaggcagtgcaggaggag
gatgagctgccacctgagaaactagcgattgccaatgtgggacggcaggatgccaagaag
cacttggaagagcatgtctcaaatttgatgtcgtcaaacatagttcagaccctaggaacc
atgctcgacacggttgtgttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338586
Entry
4338586           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 14 homolog
  KO
K03030  26S proteasome regulatory subunit N11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4338586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4338586
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4338586
   03051 Proteasome [BR:osa03051]
    4338586
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4338586
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4338586
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4338586
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF5352
Other DBs
NCBI-GeneID: 4338586
NCBI-ProteinID: XP_015637397
UniProt: Q60EW3 Q0DIQ4
LinkDB
Position
5:17870053..17873679
AA seq 307 aa
MERLQRIFGASGMGQPPSDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFV
DDYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWL
SGVDINTQQSFEALNPRAVAVVIDPIQSVKGKVVIDAFRLINPQTMMLGQEPRQTTSNVG
HLNKPSIQALIHGLNRHYYSIAINYRKNELEEKMLLNLHKKKWTDGLILKRFDTHSKTNE
QTVQEMLNLAIKYNKAVQEEDELPPEKLAIANVGRQDAKKHLEEHVSNLMSSNIVQTLGT
MLDTVVF
NT seq 924 nt   +upstreamnt  +downstreamnt
atggagcggctgcagcggatcttcggcgcctccggcatggggcagccgccgtcggactcg
ccgctgctcgactcctccgagcaggtctacatctcctccctcgccctcctcaagatgctc
aagcacgggagggccggcgtgccgatggaggtgatggggctgatgctgggggagttcgtc
gacgactacacggtcagggtggtcgacgtcttcgccatgccgcagagcgggaccggggtc
agcgtcgaggccgtcgaccatgtcttccagaccaacatgctcgacatgctcaagcagacc
gggaggccagaaatggtggtaggttggtaccattcccatcctggatttggttgctggctt
tcaggagttgacatcaatactcaacagagttttgaagctttaaaccccagggcagttgcc
gtcgtgatagatcccatccaaagtgtcaaggggaaagttgtcattgatgcatttcgcctt
attaaccctcagaccatgatgcttggtcaggagccacgacagacaacatcaaatgttggg
cacctaaataagccatctattcaggctcttattcatgggctgaacaggcactactattca
attgcaatcaattaccggaaaaatgagcttgaggaaaagatgttactgaacttgcacaaa
aagaaatggaccgatggattgattctgaagaggtttgacactcattcaaagaccaatgag
cagactgttcaggaaatgctgaaccttgctatcaagtacaacaaggcggtgcaagaggag
gatgagctgccgcctgagaaattagcgatagcaaatgtgggacggcaagatgctaagaag
cacttggaagagcatgtctccaatttgatgtcatcaaacatagttcagacgctaggaacc
atgctcgatacagttgtattttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341987
Entry
4341987           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 14 homolog
  KO
K03030  26S proteasome regulatory subunit N11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4341987
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4341987
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4341987
   03051 Proteasome [BR:osa03051]
    4341987
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4341987
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4341987
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4341987
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB
Other DBs
NCBI-GeneID: 4341987
NCBI-ProteinID: XP_015643463
UniProt: Q5Z816 Q0D9Q9
LinkDB
Position
6:complement(29711128..29713099)
AA seq 308 aa
MDANMLSAMMAAVGGDKPQPDTSEQINVSPLALLKMLKHGRAGVPMEVMGLMLGEFVDEY
TVTVADVFAMPQSGTGVSVEAVDHAFQSEMLEMLRQTGRPEMVVGWYHSHPGFGCWLSGT
DMATQQSFEQLHPRAVAVVIDPVQSVKGKVVMDAFRLVDHMAMVLGGAAGGEARQTTSNV
GAVARPSAVALVHGLGRHYYSLAISYRMKEGEERMLACLSRSGWSDGFALRRFGAHDAGN
EAAVRGMRDLAVGYGAQVREEDETPPERLAVVRAGKVDAKGKLEEKAMDAMSANIVQTLG
MMLDTVTF
NT seq 927 nt   +upstreamnt  +downstreamnt
atggacgccaacatgctgagcgcgatgatggccgccgtcggcggcgacaagccgcagccg
gacacgtcggagcagatcaacgtgtcccccctcgccctcctcaagatgctcaagcacggg
cgagccggcgtgccgatggaggtgatggggctgatgctgggcgagttcgtcgacgagtac
acggtgacggtcgccgacgtgttcgccatgccgcagagcggcaccggcgtgagcgtggag
gcggtggaccacgcgttccagagcgagatgctggagatgctccggcagacggggcggccg
gagatggtggtggggtggtaccactcccaccccggcttcggctgctggctctccggcacc
gacatggccacgcagcagagcttcgagcagctgcacccgcgcgccgtcgccgtggtgatc
gacccggtgcagagcgtcaaggggaaggtggtcatggacgcgttccgcctcgtcgaccac
atggcgatggtgctcggcggcgccgcgggcggcgaggcgcggcagaccacgtcgaacgtc
ggcgccgtcgcgcggccgtcggcggtggcgctcgtccacggcctcgggcggcactactac
tcgctcgccatcagctaccggatgaaggagggggaggagcggatgctggcgtgcctcagc
cggagcgggtggtccgacggtttcgcgctgcggcggttcggcgcgcacgacgccggcaac
gaggcggcggtgcgcgggatgcgggacctcgccgtgggctacggggcgcaggtgagggag
gaggacgagacgccgccggagaggctcgccgtggtgagggcgggcaaggtggacgccaag
gggaagctggaggagaaggccatggacgccatgtccgccaacatcgtgcagacgctcggc
atgatgctcgacaccgtcaccttctag

DBGET integrated database retrieval system