KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324398
Entry
4324398           CDS       T01015                                 
Name
(RefSeq) glutamate synthase 1 [NADH], chloroplastic isoform X1
  KO
K00264  glutamate synthase (NADH) [EC:1.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4324398
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4324398
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.14  glutamate synthase (NADH)
     4324398
SSDB
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG Pyr_redox_2 Fer4_20 NAD_binding_8 Pyr_redox Pyr_redox_3 FAD_oxidored DAO Amino_oxidase HI0933_like AlaDh_PNT_C FAD_binding_2 FMO-like FAD_binding_3 GIDA Thi4 NAD_binding_9
Other DBs
NCBI-GeneID: 4324398
NCBI-ProteinID: XP_015649242
UniProt: Q0JKD0
LinkDB
Position
1:complement(28091208..28102914)
AA seq 2167 aa
MSAAQGMAYKLRTDAAPTGAGRRARRSHSSVAAPYRAARLVQGGVSIEGGLVGGCQLTEE
RVAARPPRAAARDAEPVRPLSTLPESSIGLYDPSRERDSCGVGFVAELSGDYKRATVNDA
LEMLERMAHRGACGCEKNTGDGAGILVALPHNFFREVTKDAGFELPQPGEYAVGMVFLPI
DEKRRERSKAEFQKVAESLGHVILGWRRVPTDNSDLGESALQTEPVIEQVFLTKSSSSEA
DFEQQLYILRRLSILSIRAALNLRRGGKRDFYMCSLSSRTIVYKGQLKPCQLKGYYYADL
GHENFTSYMALVHSRFSTNTFPSWDRAQPMRVLGHNGEINTLKGNKNWMKAREGLLECEK
LGLTKDQFSKILPIVDATSSDSGAFDGVLELLIRGGRSLPEAVMMMIPEAWQNDVNMEPE
KKALYEFLSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTHSGRVVMGSEVGVV
DVPSKDVLRKGRLNPGMMLLVDFENHTVVDDEALKAQYSKAHPYGEWLKRQKIYLKDIVE
SVPETERVAPGISGSLTQKNEKKEHAGVNGIVTPLKAFGYTVEALEMLLLPMAKDGVEAL
GSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPEGDLLETT
EKQCNRLALEGPLVSIDEMEAIKKMNYRGWRSKVLDITYPKKSGRKGLEETLDRICTEAR
GAIKKGYTVLVLSDRGFSSDRVAVSSLLAVGAVHQHLVANLERTRVGLLVESAEPREVHH
FCTLVGFGADAVCPYLAIEAIWCLQNDGKIPPNGDGKPYSKEELVKKYFYASNYGMMKVL
AKMGISTLASYKGAQIFEALGLSSEVIRKCFDGTPSRIEGATFEMLARDALRLHELAFPS
RAPPPGSADAKALPNPGDYHWRKNGEVHLNDPLAMAKLQEAARVNSRAAYKEYSRRIQEL
NKTCNLRGMLKFKDTADMISVDEVEPASEIVKRFVTGAMSYGSISLEAHTALAMAMNKLG
GKSNTGEGGEQPSRMEPLANGSMNPKRSAIKQVASGRFGVSSYYLTNADELQIKMAQGAK
PGEGGELPGHKVIGDIAVTRHSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNSNPRARIS
VKLVSEAGVGVVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAETHQTLV
ANGLRGRAILQTDGQLKTGKDVAVACLLGAEEFGFSTAPLITLGCIMMRKCHTNTCPVGI
ATQDPVLREKFAGEPEHVINFFFMLAEELREIMSQLGFRTITEMVGRSDMLEVDPEVVKS
NEKLENIDLSLILKPAAEIRPGAAQYCVEKQDHGLDMALDNKLIALSKAALEKEVRVFIE
TPIQNTNRAVGTMLSHEVTKRYHMKGLPAGTIHVKLTGSAGQSLGAFLCPGITLELEGDS
NDYVGKGLSGGKIVVYPPRDSTFIPEDNIVIGNVALYGATIGEAYFNGMAAERFCVRNSG
AQAVVEGIGDHGCEYMTGGTVVILGKTGRNFAAGMSGGIAYVYDIDGKFSVRCNHELVDL
YHVEEEEDITTLKMMIEQHRLNTGSVVARDILSNFDTLLPKFVKVFPRDYKRVLDNMKAE
KAAAKLAKEPKISNGVSVTTKKVQPEQSTNRPTRVSNAKKYRGFISYERESISYRDPNER
VKDWKEVAIESVPGPLLNTQSARCMDCGTPFCHQESSGAGCPLGNKIPEFNELVHQNRWR
EALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDKGFEEGWMVPRP
PLQRTGKKVAIIGSGPAGLAAADQLNKMGHFVTVFERADRIGGLMMYGVPNMKTDKIEIV
QRRVNLMAEEGITFVVNANVGSDPLYSIERLRSENDAVILACGATKPRDLGIPGRELSGV
HFAMEFLHANTKSLLDSNLEDGRYISAKGKKVVVIGGGDTGTDCIGTSIRHGCTSIVNLE
LLTKPPSKRAADNPWPQWPRIFRVDYGHQEASSKFGNDPRTYEVLTKRFIGDENGNVKAL
EVVRVKWEKVDGRFQFKEIEGSNETIEADLVLLAMGFLGPEATIAEKLGLEKDNRSNFKA
QFGNFATSVDGIFAAGDCRRGQSLVVWAITEGRQAAAAVDKYLSRNEQDAAEDITPSGAG
FVQPVAA
NT seq 6504 nt   +upstreamnt  +downstreamnt
atgtcggcggcgcaagggatggcctacaagctccgcaccgacgcggcgcccacgggcgct
ggccgcagggctcggcgcagccactcctccgtggcggcgccttaccgcgcggctaggctg
gtacagggcggcgtgtccatcgagggcggtttggtcggcggatgccagctcaccgaggag
cgcgtcgccgcacggccgccccgcgccgccgcgcgcgacgccgagccggtcaggccactt
tcgacgctccccgagagcagcattgggctgtacgacccctcgcgcgagcgcgactcgtgc
ggcgttggtttcgtcgccgagctgtcgggcgattacaagcgcgcgacggtcaatgacgcc
ctcgagatgcttgagagaatggcgcaccgtggtgcctgcggctgtgagaagaacactggc
gatggtgccggcatccttgtggctctaccgcataactttttcagagaggtgacaaaggat
gctgggtttgagctaccgcagccaggcgagtatgctgtcggtatggtcttcctgccaatc
gatgagaagcgccgtgagcggagcaaagctgagtttcagaaggtagcggaatcgctggga
catgtaatacttgggtggcgccgggttcccactgacaactcagacttaggtgaatctgcg
ctccagactgagccagttattgagcaggttttcctcaccaaaagttcaagttcggaggct
gattttgagcagcagttgtatatcctgaggaggctctcgattctatctatccgtgcagct
ctgaatctccgtcgtggaggaaagagggacttctacatgtgttctctctcctcaaggact
attgtctacaagggccagcttaagccatgccaacttaaggggtactactatgcagatcta
ggtcatgaaaacttcacaagttatatggctctggttcactcaaggttctccacgaacacc
ttccccagctgggaccgtgcacagccgatgcgtgtattaggtcataatggagagatcaat
accctcaaagggaacaagaattggatgaaagcacgagaaggtctcttagagtgtgagaag
cttggcctaacaaaggatcagttttcaaaaattctaccaattgtggatgctacctcgtct
gattcaggtgctttcgatggtgttcttgaacttcttatccgtggtggaagaagcctgcca
gaagctgtgatgatgatgatacctgaggcatggcagaacgatgtgaacatggaacctgag
aagaaagctctctatgagttcttgtctgcccttatggagccttgggatggacctgctcta
atatcttttactgatggccgttaccttggagccaccctggatcgcaatgggttgaggcct
ggtcgattttatgtgacacacagtggacgtgtagtcatgggaagtgaagttggtgttgtt
gatgttccttccaaagatgtattgagaaagggtagactaaaccctggaatgatgctgttg
gttgattttgagaaccatactgtagtggatgatgaagcattgaaggcacagtactcgaaa
gctcacccatatggggagtggctcaagagacaaaaaatatacctcaaagacattgtagaa
tctgtgccagaaactgagagagttgctcctggaatttctggttcactcacacaaaagaat
gagaaaaaggaacatgcaggcgtcaatgggattgtgactccactaaaagcctttggatac
acagttgaagcccttgaaatgctgcttctcccgatggctaaagatggagttgaagctctt
ggatccatgggaaatgacacacccttggcagtcatgtcaaacagagagaagttgactttt
gagtacttcaaacagatgtttgcacaagttacaaacccgccaatcgacccaattagggag
aaaattgttacatctatggagtgtatgattgggccagaaggtgacttgttggaaacaact
gaaaagcaatgcaaccgccttgcacttgagggtcctttggtgtcgattgatgaaatggag
gctattaagaagatgaactaccgtggttggcgaagcaaggtgctcgacataacttatcca
aagaagtctggaaggaagggcttggaagaaactttggacagaatttgcacagaagctcgg
ggagctataaagaagggctacactgttttagttctctcagatagaggattttcctcagac
cgtgttgctgtcagttcgctcttagcagttggcgcggtacatcagcatcttgtggccaat
cttgagaggacgcgcgtaggtttgttggtggagtctgctgaacctcgtgaagtgcaccac
ttctgcacccttgttgggtttggtgctgatgctgtatgcccttatttggctatcgaagca
atttggtgcttgcagaatgatgggaagattcctcctaatggtgatgggaaaccctactca
aaggaagaacttgtcaagaaatatttctatgcttctaactatggaatgatgaaagttctt
gcaaagatgggaatttccacccttgcatcttacaaaggtgcacagatttttgaagctctt
ggcctttcctctgaagtcatccgtaagtgttttgatggtacacctagccgaattgaaggc
gccacttttgaaatgcttgcacgagatgctctacgtcttcatgagttggcatttccatca
agagcacctccaccaggaagtgcagatgcaaaggcccttcccaatccaggggactaccac
tggaggaaaaatggtgaagtccacctcaatgatccccttgcaatggcaaaactacaagaa
gctgctagagtaaacagccgggcagcatacaaagaatattctaggcgtattcaggagctc
aacaaaacctgcaacctgcgtggtatgcttaaatttaaagacactgctgacatgatttct
gtggacgaggttgaacctgcaagtgagatcgttaaacgctttgttactggtgcaatgagt
tatggatccatttctttggaagcacatactgcccttgctatggccatgaacaaacttgga
gggaaatctaatacaggtgagggaggggaacagccttctcgtatggaaccacttgctaat
ggttcaatgaatccaaaaagaagtgcaatcaagcaagttgccagtggaagatttggagtt
tcaagctattatctgactaacgctgatgaactgcagataaaaatggctcagggtgctaag
cctggtgaaggtggtgagcttccaggccacaaggttattggtgacattgcggttacaaga
cactctactgctggtgtaggactgattagcccacctcctcaccatgacatatattctatt
gaggatcttgcacaacttatccacgaccttaagaattcaaatcctagagctcgcataagc
gtcaagctagtttctgaggctggtgtaggagttgttgctagtggtgttgtaaaaggacat
gcagaccatgtccttatatctggccatgatggagggacgggagcttctaggtggacaggt
attaaaaatgctggccttccatgggaacttggattggctgagacacatcaaactctagtg
gcaaatgggcttcgtggccgagctattctgcaaactgacgggcagttaaaaactggcaaa
gatgtagctgttgcttgcttacttggcgcagaagaatttggtttcagtactgctccgttg
atcacacttggttgcatcatgatgcggaaatgtcataccaacacttgccctgttggtata
gctactcaagatccagtgctacgagaaaagtttgctggagaaccagagcatgttatcaac
ttcttcttcatgcttgctgaggagctaagagaaatcatgtctcagcttggcttccgtacc
attactgaaatggttgggcgctctgacatgcttgaggttgatccagaagtagtgaagagc
aacgagaaacttgagaacattgatctctcattgattttgaaaccagctgcagagattcgc
cctggggctgctcagtactgtgttgaaaagcaagatcatggtcttgacatggcattagat
aacaaactcatagctttatcaaaagctgcacttgagaaggaagttcgtgttttcattgag
actccaatccagaatactaaccgagcagtaggcactatgcttagtcatgaagtcacaaag
cgttatcacatgaagggattacctgcaggtacgattcatgtgaagctcactggaagtgct
ggtcaaagtcttggcgcttttctctgtcctggaatcacccttgagcttgaaggagacagc
aatgattatgttggcaaaggattgtctggcggaaaaattgttgtctacccaccaagagat
agtacatttattccagaagacaatattgtaattggtaatgtggctctatatggtgctact
ataggagaggcatatttcaatggaatggctgcagaaaggttttgcgtgcgcaattcaggt
gctcaagctgtggttgaaggaattggtgatcatgggtgtgagtacatgacagggggtact
gtggttatccttggtaaaacaggaagaaactttgctgctgggatgagtggaggcattgct
tatgtttatgatattgatgggaaattcagcgtccgctgtaaccatgagttagttgatctc
tatcatgtggaggaagaggaagacattaccacattgaaaatgatgatagaacaacatcga
cttaacactgggagtgttgttgctagagatatactctctaattttgatactcttcttcca
aaatttgtcaaggtattcccaagagattataagagggttttggacaatatgaaggctgaa
aaggctgctgctaagcttgcaaaggaaccaaagatttcaaatggtgtttctgtaaccact
aagaaagtgcaaccggagcaatcaacaaaccgaccaacacgtgtttccaatgccaaaaag
taccgaggtttcatttcatatgagcgagagagtatttcttaccgggatccaaatgagcgt
gtaaaagattggaaggaagttgcaattgaatcagtgccagggccactactgaacacacag
tctgctcgttgtatggattgtggaactcctttctgtcatcaggaaagctcaggtgctggc
tgtcctcttggaaataagattccagagttcaatgaactggttcaccagaacagatggcgt
gaagcactagatcgtctgcttgagacgaacaacttccctgaatttactggaagagtatgc
cctgctccctgtgagggatcatgtgttcttggcattattgaaaatccagtatctatcaaa
agcatagaatgtgcgatcatagacaaaggttttgaagagggatggatggtaccgcggcct
ccacttcaaagaacaggaaagaaggttgccatcattggaagtggtccggctggtttggct
gctgcagatcaactaaacaaaatgggccattttgttactgtgtttgaacgtgctgatcgt
attggtggtctgatgatgtatggagtgccaaacatgaagacagacaagattgaaattgtg
caacgccgtgtcaatttaatggcagaagagggcattacatttgtagtgaacgctaatgta
ggcagtgatcctttgtattcaattgagcgcctccgttctgagaatgatgcagtcattttg
gcttgtggagctactaaaccaagggatctaggtattcctggacgcgagttatcaggagtt
cattttgccatggagttcctccatgcaaatacgaaaagtttacttgacagcaacttggag
gatggtagatacatatctgccaaggggaaaaaggttgtggttattggtggtggtgacaca
ggcacagattgcattggtacatctattcggcatggttgcaccagcattgtaaaccttgaa
cttcttaccaaaccaccaagcaagagagcagctgataacccatggccacagtggcctaga
atcttccgtgttgactatgggcaccaggaagcatctagtaagtttggaaatgacccaaga
acttacgaagtcctgaccaagcgttttattggtgatgaaaatggaaacgtgaaggccctt
gaggtggtccgggtcaagtgggagaaagtcgatgggagattccagttcaaagaaattgaa
ggctcaaacgagaccattgaggctgatcttgtcctcctagctatggggttcctaggccct
gaagcgactattgctgagaaactaggtttggagaaagacaaccggtctaacttcaaagct
caatttggaaactttgcaaccagtgtggatggcatttttgctgccggggactgcagacgt
ggacaatcacttgttgtttgggccatcaccgaggggcggcaagctgctgcagctgtcgac
aagtacttgtcaaggaatgaacaagatgccgcagaggacataaccccctcgggtgcaggt
tttgtgcagcctgttgcagcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339561
Entry
4339561           CDS       T01015                                 
Name
(RefSeq) glutamate synthase 2 [NADH], chloroplastic
  KO
K00264  glutamate synthase (NADH) [EC:1.4.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4339561
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4339561
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.14  glutamate synthase (NADH)
     4339561
SSDB
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG Pyr_redox_2 Fer4_20 NAD_binding_8 Pyr_redox DAO Pyr_redox_3 FAD_oxidored Amino_oxidase HI0933_like GIDA FAD_binding_3 FAD_binding_2 AlaDh_PNT_C FMO-like Thi4
Other DBs
NCBI-GeneID: 4339561
NCBI-ProteinID: XP_015640407
UniProt: Q0DG35
LinkDB
Position
5:27622110..27636451
AA seq 2188 aa
MSAAQGLALKLRAAPAAGGVRGEKRRRAASATAAAAARPRHGAMSLEGGFLGGALPAEDR
VAPRASASRQAEAGAGAGAARPPPRSMSKIPESSIGLYDPSMERDSCGVGFIAELSGEYS
RKTVDDAIEMLDRMAHRGACGCEKNTGDGAGILVALPHNFFREVTKDAGFELPPPGEYAV
GMFFMPTDDKRREKSKLLFREKAELLGHTVLGWRRVPTDNSGLGQSAVDTEPVIEQVFVT
KSASSKADFERQMYVLRRFSVMSIREVLGVKNGGTKDFYMCSLSSRTIVYKGQLKPSQLK
GYFFADLGDESFTSYMALIHSRFSTNTFPSWDRAQPMRVLGHNGEINTLRGNKNWMKARE
GLLKCEGLGLTRDEMLKLLPIVDATSSDSGAIDNVLELLIQSGRSAPEAVMMMIPEAWQN
DVNMDPERKALYEFFSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTYSGRVIM
ASEVGVVDVPPQDVSRKGRLNPGMMLLVDFENHCVVNDDELKKEYSKVRPYGEWLKRQRI
QLTDIIESVNEAERIAPSISGALPITKENKADMGICGILTPLKAFGYTREALEMLMLPMA
KDGQEALGSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPE
GDLSETTERQCHRLTLKSPLLNTNEMEAIKKMNYRGWRSKVLDITYPKKNGRMGLKQTLD
KICAQAREAIHEGYTILVLSDRGFSSERVAVSSLLAVGAVHQHLVSHLERTRIGLLVESA
EPREVHHFSTLIGFGADAICPYLAIEAIWRLQIDGRIPPNDGKPYTQEQLIEKYFYASNY
GMMKVLAKMGISTLASYKGAQIFEALGLASEVVSKCFEGTPSRVEGATFEMLAQDALRLH
EIAFPSRTLPPGSADANALPNPGDYHWRKNGEVHLNDPFSIAKLQEAARINSREAYKEYS
RRIYELNKACTLRGMLKFREIPNQISLDEVEPAKEIVKRFCTGAMSYGSISLEAHTSLAE
AMNTLGGKSNTGEGGEQPCRMVPLPDGSKNPRISAIKQVASGRFGVSIYYLTNAVEVQIK
MAQGAKPGEGGELPGHKVIGDIAVTRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNAN
PGARISVKLVSEAGVGIVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAE
THQTLVANGLRGRAVLQTDGQMKTGRDVAVACLLGAEEFGFSTAPLITLGCIMMRKCHTN
TCPAGIATQDPVLRAKFAGKPEHVINYFFMLAEEVREIMAQLGFRTVNEMVGRSDMLEID
PKVLEGNEKLENIDLSRLLKPAAEISPGAVQYCVEKQDHGLDMALDNKLIASSTAALRKG
VRVFIETPVRNINRAVGTMLSHEVTKRYHIHGLPSDTIHIKLNGSAGQSFGAFLCPGITL
ELEGDSNDYVGKGLSGGKIVVYPPRNSRFNPQDNIVIGNVALYGATKGEAYFNGMAAERF
CVRNSGAQAVVEGIGDHGCEYMTGGTAVILGKTGRNFAAGMSGGIAYVYDVDGKFSSRCN
YELVDLYAVVEEDDITTLRMMIQQHRLHTQSDLARDILLNFDTLLPKFIKVYPRDYKRVL
DKLKEEKAAKEAEQKAREVVDKKPVEVIQAPNGISVKTEKVMNEEPSSRPSRVSNAVKYR
GFIKYEREGTSYRDPNERVKDWNEVAIELVPGPLLKTQSARCMDCGTPFCHQEGSGAGCP
LGNKIPEFNELVHQNRWHEALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIDNPVSIKSI
ECAIIDKGFEEGWMVPRPPLRRTGKRVAIVGSGPAGLAAADQLNKMGHFVTVFERADRIG
GLMMYGVPNMKADKEGIVQRRVELMAKEGVQFIVNAHVGSDPLYSVEKLRSENDAIILAC
GATKPKDLPIPGRELAGIHFAMEFLHANTKSLLDSNLEDGNYISAQGRKVVVIGGGDTGT
DCIGTSIRHGCTNLVNLELLPEPPRKRAPDNPWPQWPRIFRVDYGHQEATSKFGKDPRSY
KVLTKRFIGDENGNVKALEVIRVEWGKVNGRFQFKEVEGSEEIIEADLVLLAMGFLGPEA
TVANKLGLEQDMRSNFKAQFGNFATNVEGVFAAGDCRRGQSLVVWAITEGRQAAAAVDNY
LSKDDEGETNGTEDIAVSSEGLVQPVVA
NT seq 6567 nt   +upstreamnt  +downstreamnt
atgtcggcggcgcagggccttgcgctgaagctgcgcgccgcgccggcggcgggtggcgtc
cgcggggagaagcggcgccgcgcggcatcggcgaccgcggcggcggcggcgcggcctcgc
cacggcgccatgtcgctggagggcgggttcctcggcggcgcgctccccgccgaggaccgg
gtggcgccgcgggcatcggcgtcgcgccaggcagaggcgggggctggggcgggggcggcg
cgtcctcctcccaggtcgatgtcgaagatccccgagagcagcattgggctgtacgacccc
tccatggagcgcgactcctgcggcgtcggcttcatcgccgagctctccggcgagtacagc
cgcaaaacggtcgacgacgccatagagatgctcgatagaatggctcaccgtggcgcctgc
ggctgcgagaagaacaccggagatggcgcaggcatcctcgtcgctctgccgcacaacttc
ttcagagaggtcacgaaggacgcaggttttgagcttccgccgcctggtgagtacgccgtc
gggatgtttttcatgcccacagatgacaaacgccgtgaaaagagcaagcttttgtttcgt
gagaaagcagagttgctggggcataccgtcctcggctggcgccgggttcccacagacaac
tcgggcttgggtcaatcagcggtagatacagaaccagtgattgagcaagtgtttgtcacc
aaaagtgcaagttcaaaggctgattttgagcggcagatgtacgtcctacggaggttctca
gttatgtccatacgagaagttctaggcgtcaagaatggcggaacaaaagatttctacatg
tgctctctatcttcaaggaccattgtttataagggtcagcttaagccaagccaactcaag
gggtacttctttgcagacttaggcgatgaaagcttcacaagttacatggcactgatccac
tcaagattttccacgaacaccttccctagttgggatcgagcgcaaccaatgcgtgttttg
gggcataatggcgagatcaatacccttagagggaacaagaactggatgaaggcacgtgag
ggtctcttgaagtgcgagggactaggtctaacaagggatgaaatgttgaaacttctgccg
atagtggatgctacatcttcggattcaggtgcaatcgacaatgttcttgagcttctcata
caatctggaagaagtgcgccagaggctgtcatgatgatgatccctgaggcgtggcaaaac
gatgttaacatggaccctgagagaaaagctttgtatgagttcttttcagcacttatggag
ccttgggatggaccagctctaatctcatttactgatggccgctaccttggtgcaaccctt
gatcgtaatggtttgaggccaggccggttttatgtgacctacagtggccgtgtaattatg
gctagtgaagttggtgtggtcgatgttcctcctcaagatgtttcaagaaagggtaggcta
aaccctggaatgatgcttttagttgattttgagaaccattgtgttgtgaatgatgatgaa
ttgaagaaagagtactccaaagttcgtccatatggagagtggctgaaaagacaaaggata
caactcacagatatcatagaatctgtaaatgaagcagagagaattgcaccgagcatttcg
ggtgcacttccaattacaaaggagaacaaagcagatatgggtatctgcggaattctgact
ccgctgaaggcttttgggtatacaagagaagcccttgaaatgctgatgctaccgatggcc
aaagatggacaagaagctcttggatcaatgggaaatgatactcctctagctgtgatgtca
aacagagagaagctgacttttgaatacttcaagcagatgtttgcacaagttacaaaccca
ccgattgacccgatccgggagaaaattgtcacatctatggagtgcatgattggtcctgaa
ggtgacttgtctgaaacaacagagcggcagtgccatcgcctcacgcttaagagtccttta
ctgaatacaaatgaaatggaggctattaaaaagatgaactaccggggttggcgcagcaag
gtgcttgacataacttatcctaaaaagaatggcaggatgggcttaaaacagactttagat
aaaatttgtgctcaagcacgtgaagctattcatgagggctacactattctagttctctct
gatagaggtttttcttcagagcgtgtagctgtcagttccctattggcagttggagctgtc
catcagcaccttgtctcacatcttgagaggacacgcataggattgttagttgaatctgct
gaacctcgcgaagtgcaccatttttccacccttattggatttggtgctgatgctatatgc
ccttatttagctatagaagcaatatggcggttgcaaattgatgggaggattcctcctaat
gatgggaaaccttatacacaagaacaacttatcgagaaatatttttatgcttcaaactat
ggaatgatgaaagttcttgcgaagatgggaatatccactctggcatcttacaaaggtgct
cagatttttgaggcccttggtcttgcttcggaagtggtcagcaagtgttttgaaggtact
cctagtagagttgaaggtgcaacctttgaaatgcttgcacaagatgctcttcgtctccat
gagattgcattcccatcaagaactttacctcctggaagtgcagatgcaaatgctcttccc
aaccctggggattaccattggaggaaaaatggagaagtacaccttaatgatcctttttcc
attgcaaaattacaagaagcagcacggattaacagcagggaagcatacaaagaatattct
aggcgcatttacgagctgaataaggcatgtactctgcgtggcatgctgaaatttagagaa
attccaaaccaaatttccttggacgaggtagaacctgcaaaggagatagtgaagcggttc
tgtactggagcaatgagttatggatccatttccttggaagctcatacttccctggctgag
gctatgaacacccttggaggaaaatctaacacaggtgagggaggggaacaaccttgccgt
atggtgcctcttcctgatggatcaaagaatccaagaataagtgcaatcaagcaagttgcc
agcggaagatttggagtttccatctattatttgactaatgcagttgaggtgcagataaaa
atggctcagggtgctaaacctggtgaaggtggtgagctaccaggccacaaggtcattggt
gatattgcagtcactagaaattctacagctggtgtagggctcattagcccacctcctcac
cacgatatatattctattgaggatctcgcacaacttatccatgaccttaagaatgcaaac
ccaggtgccagaatcagcgtcaaactagtctctgaagctggtgtaggaattgtcgctagt
ggtgtggtgaaaggacatgcagaccatgttctgatctctggacatgatggaggcactgga
gcctccagatggacagggattaaaaatgctggacttccttgggagcttggattagctgaa
acacaccagactcttgtggccaatggtctccgtggccgagctgttcttcagacagatgga
cagatgaaaactggtagagatgttgctgttgcttgtttacttggagcagaagaatttgga
ttcagcacagcgccattaatcacacttggctgcattatgatgaggaagtgccataccaac
acttgccctgctggtattgctacacaagatccagtgctccgcgcaaagtttgctgggaag
ccagaacatgtcataaactacttcttcatgcttgctgaagaggtacgagaaatcatggca
cagcttggcttccgcactgttaatgaaatggttgggcgatcggacatgcttgagatcgat
cccaaagtactggagggcaacgagaaacttgaaaacattgatctctcacggctgctgaaa
ccagctgctgaaattagccctggggctgttcaatattgtgttgagaagcaagatcatggc
ctcgacatggcattagataacaaactcatagcctcctcaacagctgcccttcgaaaaggt
gttcgtgttttcattgagacaccagtacggaacattaaccgagctgttggtactatgctc
agccatgaagtcacaaaacggtatcacattcatggattgccatcagataccatccatatt
aagctgaatggaagtgctggccaaagttttggtgcttttctctgtcctgggatcactctt
gagcttgagggagacagcaacgattatgttggtaagggactatctggtggaaagattgtt
gtgtatccaccaagaaatagtcgatttaatccacaagacaatattgtgattggtaatgtg
gctttatatggtgctacaaagggagaggcatatttcaatggtatggcggcagaaaggttt
tgtgtccgcaattcaggagctcaagcagtagttgaagggattggcgatcatggatgtgag
tacatgacaggaggtacagctgttattcttggaaaaactggtaggaactttgcagctggc
atgagtggaggtattgcttatgtttatgatgtggatgggaagttcagtagccgttgcaac
tatgagctagttgacttgtatgctgtagttgaagaggatgacatcacaacattgagaatg
atgatacaacagcacagacttcatacacaaagtgatttggccagagatatactcttgaat
tttgatactctcctcccaaaatttataaaagtatatccaagggattacaagcgggttttg
gataaactaaaagaagagaaggctgctaaagaagcagagcaaaaggcaagagaagtggtg
gataagaagccagttgaagtaattcaagctccaaatggcatttcagtaaagacagagaaa
gtaatgaacgaagagccatcaagccgaccatcacgagtttcaaatgctgtaaagtaccga
ggtttcataaaatatgagcgagagggtacttcttacagagatccaaatgagcgtgtaaaa
gattggaatgaagttgcaattgaattggttcctgggccactgctaaagacgcaatctgct
cggtgcatggattgtggcactcctttctgtcatcaggagggttctggtgctggttgtcct
cttggaaataagattcctgaattcaatgaattggttcatcagaatagatggcatgaagcc
ttggatcggctacttgagacaaacaatttccctgagtttactggacgagtttgtcctgct
ccttgtgagggttcgtgcgtacttggcattatagacaatccagtatccataaaaagcata
gagtgcgccatcatagacaaaggatttgaagagggatggatggtaccacggcctccactt
cggagaacaggaaagagagttgctattgttggcagtggcccagctggtctagctgctgca
gaccaactgaacaaaatgggccatttcgtgactgtctttgaacgtgctgaccgtattgga
ggactgatgatgtatggggttccaaatatgaaggctgacaaagagggcattgttcagcga
cgtgtcgagttgatggctaaggagggggttcaattcattgtgaatgcccatgttggaagt
gaccctttatactccgttgaaaagctccgctctgagaatgatgccattattttggcctgt
ggagctacaaagccaaaagatctccctattcctggacgggagttggcaggcatccatttc
gctatggaatttcttcatgccaataccaaaagtttacttgacagcaacttggaggatggt
aactacatatcagcccaagggagaaaggtggttgtcattggtggtggagacacaggcaca
gattgcattgggacatccattaggcatggttgcaccaaccttgtaaatcttgaacttttg
ccagagccaccaagaaagagggcacctgacaacccctggccccagtggcccaggatcttc
cgtgttgattatgggcaccaggaagcaactagcaagtttggaaaagatccaagaagttac
aaagtcctgacgaagcgatttatcggagatgagaatggaaatgtgaaggcccttgaggta
atacgtgttgaatggggaaaggtgaacggaaggttccaattcaaggaagttgaaggatca
gaagaaattattgaggccgatcttgtcctcttagctatgggattcctgggtcccgaagcg
actgttgctaacaagctgggtctagaacaagacatgaggtcaaacttcaaagctcaattt
ggaaactttgcgaccaatgtggaaggtgtatttgctgctggagactgcagacgtgggcaa
tcactggttgtttgggccatcacagaggggcgccaagctgcagcagccgtagacaattac
ctgtcgaaggatgatgaaggtgaaaccaatggcacagaggacattgctgtctcaagtgaa
ggtctggtccaacccgtagttgcatag

DBGET integrated database retrieval system