KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324412
Entry
4324412           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 15b isoform X1
  KO
K13098  RNA-binding protein FUS
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4324412
  09122 Translation
   03015 mRNA surveillance pathway
    4324412
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4324412
Spliceosome [BR:osa03041]
 Complex A
  Other components
   Complex A specific factors
    4324412
SSDB
Motif
Pfam: zf-RanBP RRM_1
Other DBs
NCBI-GeneID: 4324412
NCBI-ProteinID: XP_015620895
LinkDB
Position
1:3322767..3328319
AA seq 535 aa
MSGSYGSDDYRGGYGGRGRVGILRVVCVLASGSAPDWLVVFFVGGGGGGRGRGGGGGGGG
GYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGR
GGGRDGDWVCPDPSCGNVNFARRTECNKCGAPSPAGGGGGGGGGGYNKSGGGGGGYNRGG
GDFSSGGGGGYNRGGGDYNSGGRGGGTGGGGRGGGYNRGGGDDRGFDDHRGGRGGYGGRD
QGNNQRGDESGYDAGSYGQVPPQGPPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSY
GGGPGSYPPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGG
GGGGGGGGGGGYTGSAAPEPAAKVKQCDANCDETCDNARIYISNLPPDVTVEELQELFGG
IGQVGRIKQKRGYKDQWPWNIKIYTDDSGKNKGDACLAYEDPSAAHSAGGFYNNYEMRGY
KISVAMAEKSAPRAPAYGHGGGRGGYGGGRRDNFRDGGGHGPNRHQGGGSRSRPY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtcggggtcgtacggatccgacgactaccgcggcggctacggcggccgaggtcgcgtc
gggatcctgcgggttgtgtgcgtgcttgcttctggatctgctcctgactggcttgtggtt
ttttttgtaggtggcggcggaggcggccgtgggaggggaggtggcggaggaggaggggga
ggatatggtggtggtggtgtgggaggtggatatggtggtggtggcggaggatatggcggc
ggtggcggagggtacggcggcggtggtagaggtggcggtggaggaggaggctacggcggc
ggtggcggcggcgggagaggtgggggtgggggtggcggtggccgaggtggcggcgggagg
ggtggaggacgtgacggtgactgggtttgcccagacccgagttgtggcaatgtgaacttt
gcaaggaggactgaatgcaacaagtgtggagcaccttctcctgctggaggtggaggtgga
ggtggaggtggagggtataataaatctggtggagggggtggaggctacaatcgtggtggt
ggcgattttagttctggaggtggcggtggctacaacagaggtggaggagattacaactct
ggtggccgtggtggtggcactggagggggaggaagaggaggaggttacaatagaggtggt
ggcgatgatcgtggatttgatgaccaccgtggtggcaggggtggttatgggggaagagac
caagggaacaaccaaaggggagacgaaagtggttatgacgctggtagctatggacaagtt
cctcctcaaggtcctccttcctatggtgggcctggtggtgactatgcagcacctccaagc
tcctatggaggcaataatgcatacaattcagattctgcagtgccacctcctagtagctat
ggtggtggtccaggttcatatccaccaagttatggtgcaccacctccgaacccgccatat
agcggtggtgctccaggtggccaaggtagcctacctccttcatatgatggtgggtatggt
ggtcggcctatgcctgggggtggaggccctggtgcacctccaccctatcatggtggtggt
ggtggtggtggtggcggcggcggtggcggcggatacactggcagtgctgctccagagcca
gctgcaaaggttaagcagtgtgatgcaaactgtgatgagacttgtgataatgcaagaatt
tacatctccaacttacctcctgatgtgactgttgaggaactgcaagaactatttggagga
atcggccaggttggaaggatcaagcagaaacgtggctacaaagaccagtggccctggaac
ataaagatctatactgatgactctggaaagaataaaggagatgcctgccttgcctatgaa
gatccttctgctgctcattcagctggtggattctataacaattatgaaatgagaggctat
aaaattagtgttgcgatggctgagaaatcagctcctagagctcctgcatatggtcatgga
ggtggacgtggtggctatggtggaggtcgcagggataacttcagagatggaggaggccat
gggcctaacaggcatcaaggtggtggttcgcgttcaaggccatactga

DBGET integrated database retrieval system