KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324417
Entry
4324417           CDS       T01015                                 
Name
(RefSeq) protein BREAST CANCER SUSCEPTIBILITY 2 homolog B isoform X1
  KO
K08775  breast cancer 2 susceptibility protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4324417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4324417
   03036 Chromosome and associated proteins [BR:osa03036]
    4324417
   03400 DNA repair and recombination proteins [BR:osa03400]
    4324417
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4324417
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4324417
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     4324417
   FA (Fanconi anemia) pathway
    Downstream FA components
     4324417
SSDB
Motif
Pfam: BRCA2 BRCA-2_OB1 BRCA-2_helical BRCA-2_OB3
Other DBs
NCBI-GeneID: 4324417
NCBI-ProteinID: XP_015622733
LinkDB
Position
1:complement(3343483..3355094)
AA seq 1574 aa
MQRRWQVWGKPDGSLVWVPASDGPPPPAAAASEAPLPRPDPQPAATELGEARSGDAIPEG
PGAADGCSVPSMADLFNQALDKLVAADGMAEAIEDSGKGAVFCTGLGGSVAVSERAVERA
KALVGEVAEEISNERRQPFGDGSNLECGLGESNVSFKGGVHKDSLSPMFQTGSGKMVSLS
KGSIQKARAVLEGNAENSSVIAVQSMFHTGLVRPDPVSRSSTDNAMTVLEGQTNPKQGDV
ADVYDKENFPLFQTGSGKAVSVSVASIQKAKAVLEQNNTVENTEDFGRPDQSLIFQTGSR
RPVLISERSSSVVKDGGAENIVFQTGLGRPVVVSQTSIQKARTVLDQECAKRSGHGDTNV
STTTFQTETPTSVLMSGGLTMNDRSVTPEGGVSMQGNFLEADGHLPLFQTGLGRSISVSK
GSIKRASALLEPRNITKELEDEAHSDDGCATPMFKTGSGRSITASENSRKKAHVVLEGEE
PVKNVNNDTGEAIAPMLHAGMQKFAPQNRNSSHKAITLMEQGSSMKEEYIDRGNEPPMFR
TGSGKSVLISHSSVQKARAVLEEEGNMKKENHKQLSNVDKYIPIFTSPLKTSYARTVHIS
SVGVSRAATLLGLEENTLSTQLLGHVGDKLGTKITVERENSEHQFGVASVSGISGGCPIS
SGPAENQVLMDPHQHFAFSKTTFSDSSEQAIRFSTAGGRTMAISSDALQRAKNLLGESDL
EVSPNNLLGHSSASACKENIQNSTGLRKEGEPDLLKSRGNSKTEPAQFSIPAKPDRKHTD
SLEYAVPDATLANGNSVRLHAARDFHPINEIPKISKPSSRCSFGTENASDTKDKARRLQM
PSGPLIDITNYIDTHSVNTDYLAGEKRRFGGRNSISPFKRPRSSRFIAPININNPSPSGV
SKLPIQINPCRTKLSSCYPFQHQRKSCEEYFGGPPCFKYLTEDVTDEVKLMDAKKAEKYK
FKTDTGAEEFQKMLLACGASLTYTTKEWVSNHYKWIVWKLASLERCYPTRAAGKFLKVGN
VLEELKYRYDREVNNGHRSAIKKILEGNASPSLMMVLCISAIYSCPDLNNSKPEDDRAHT
DDDNSENKSLRPAKRNMSTKIELTDGWYSLDASLDLALLEQLEKRKLFIGQKLRIWGASL
CGWAGPVSFHEASGTVKLMIHINGTYRARWDETLGLCKHAGVPLAFKCIKASGGRVPRTL
VGVTRIYPVMYRERFSDGRFVVRSERMERKALQLYHQRVSKIAEDIQSEHGEHCDNTDDN
DEGAKICKMLERAAEPEILMSSMSSEQLLSFSYYQEKQKIVRQNEVAKKVENALKVAGLS
SRDVTPFLKVRVTGLISKHSATKSGCREGLITIWNPTEKQKSDLVEGQIYSVTGLLASSY
FTEVSYLSGRGSSTAWTPLATAQTTNFEPFFTPRKAVELSHFGEVPLTSEFDIAGVILYV
GNVYLLNNQNRQWLFLTDGSKFISGEKYEEQDDCLLAVSFSSKTTGEDSAFFNYALSGHI
VGFSNLVKRDKDQMRHVWVAEATESSTYSLSHEIPKKSHLKEAATSAEKWASNSHPMIQH
LKERVLQIVGDSGG
NT seq 4725 nt   +upstreamnt  +downstreamnt
atgcagaggaggtggcaggtgtgggggaagcccgacgggagcctcgtctgggtacccgcc
tccgacgggccgccgccaccggcggcggcggccagtgaggcgccgcttcctcgtcccgat
ccgcagccggctgcgacggagctgggagaggcgcgatccggcgatgcgattcccgaaggc
cccggcgccgccgatggatgcagcgtcccgtcgatggctgacctcttcaaccaagctttg
gataagctggttgctgctgatggaatggccgaagcgatcgaggattcagggaaaggtgcg
gtgttctgcactgggttggggggatcagttgccgtcagcgagagggctgtagagagggcc
aaggcattggttggggaggtcgcggaggagataagtaatgagagaaggcaaccatttggt
gatggttctaatttggagtgcggattgggagaaagtaatgtttcatttaaaggtggtgta
cataaagatagtttgtctccgatgttccaaaccggatcgggtaaaatggtttcactgagc
aagggctcaattcagaaggctagagctgttttagaaggaaatgccgagaattcttctgtc
attgctgtacagtctatgttccatactggattggttaggccagacccagtcagcaggagc
tccactgataatgcaatgactgttttggagggacaaacaaatccaaaacaaggagatgtg
gcagatgtgtatgacaaggaaaattttccattgttccaaactggttcaggtaaagctgta
tcggtcagtgtagcatctatccagaaagctaaggctgtcctggagcaaaataatacagta
gaaaacacggaagattttggtaggcctgaccaatctctgattttccaaactggttcgcga
agaccagtcttgatcagtgaaagatctagctctgtggtgaaggatggaggtgctgaaaat
attgtgttccaaacggggttagggaggcctgttgtggtgagccagacctcaattcaaaag
gcaaggacagtattagatcaagaatgtgccaaaagaagtggacatggagatactaatgtc
tccaccactacttttcaaactgaaacaccaacgtctgttctgatgagtggtggcctgact
atgaatgatagatctgttacacctgaggggggtgtttcaatgcaaggaaattttttggag
gctgatggtcacttgccattatttcaaactgggttagggaggtccatttcagtaagtaaa
ggctcaattaagagagcaagtgcacttctggagccaaggaacattacaaaagaactggaa
gatgaagctcactcagatgatggctgtgccactccaatgttcaaaactggatcaggaagg
tctatcacagcaagtgaaaattctagaaagaaagcccacgttgtcttagagggcgaggaa
ccagtaaaaaatgtaaataatgacactggagaagccattgctccaatgctccatgctgga
atgcagaagtttgcaccccaaaatagaaactcaagtcataaggcgatcaccctcatggag
caagggagctctatgaaagaagaatacatagaccgtggaaacgaaccaccaatgtttcga
actggatctgggaagtcagtcttgattagtcacagctccgtgcagaaggcaagggcggtt
ctggaggaagaaggcaatatgaagaaagaaaatcacaaacaacttagcaatgtggacaaa
tatattccgatctttacttcacctctcaagacaagctatgcaaggactgtacatatatct
tcagttggtgtttctcgagctgcaactttgttgggtttggaggagaataccctttcaaca
caacttttaggacatgtgggtgataagctaggtacaaagataactgttgagagggaaaat
tcagagcaccagtttggtgtagcatcagtcagtggaatttctggtggctgccctataagc
tctggcccagctgaaaaccaagtacttatggatccacatcagcattttgcattttctaaa
acaacgttctctgattctagtgagcaagctatcaggttcagcactgctggcggcagaaca
atggctatttctagtgatgcacttcagcgtgcgaaaaatcttctgggtgaatcggattta
gaggtttcaccaaataatttattaggccactcttcagcatctgcttgtaaagagaatata
caaaattcaactggtctgcgaaaagaaggtgaacctgatttattgaaaagtagggggaac
agcaaaactgagccagcacaattttccattccagcaaaacctgataggaagcacacagat
tccttggaatatgctgtacctgatgccactttggctaacggaaactccgtcaggcttcat
gcggcaagagattttcatcctatcaatgaaattccaaagatatccaagccttcttccaga
tgttcatttggaactgaaaatgcaagtgacactaaagataaggctcgaagactccaaatg
ccatctggaccattgattgacatcactaattacatcgatacacattctgttaatactgac
tacctggccggtgagaagagaagatttgggggaagaaactccatatctccctttaaacgt
cctcgttcttccaggttcatcgcacctatcaacatcaataatccatccccttctggagta
tccaaactacctattcagattaatccctgtcgaacaaagctatcttcatgctatcctttt
caacatcaaagaaaatcgtgtgaagagtattttggtggtcccccatgcttcaaatatttg
acagaagatgtaacagatgaagtgaagctcatggatgcaaaaaaggctgagaagtacaag
tttaaaacagatactggtgcagaagaatttcagaagatgcttcttgcctgtggtgcttca
ttgacatacacaactaaagaatgggtcagcaaccactacaaatggattgtttggaagctt
gcttcattggagagatgctatccaactagagctgctggcaaattcttaaaagttggtaat
gttttggaagagctgaagtacaggtatgacagagaagtgaacaatggccaccgctcagcc
ataaagaaaattttggaagggaatgcttcaccatctttgatgatggtgctgtgcatttct
gctatttactcttgtcctgacctaaacaacagtaagccagaggatgatagggcacataca
gacgacgacaacagtgagaataaaagcttgagacctgctaaaaggaacatgtctacaaag
attgaactaactgatggatggtattctctagatgcgtcattagatctggcacttttggag
caactagagaaaagaaaactttttataggacagaagcttcggatatggggagcttcacta
tgtgggtgggctgggcctgtgtcatttcatgaggcatcgggtaccgtcaaattaatgatc
cacataaatggcacctatcgtgcaagatgggatgagactttggggttatgcaagcatgct
ggagtcccactggcattcaagtgcataaaagcttcaggtggcagagttcctaggacactg
gttggagttacaaggatttatcctgttatgtacagggagaggttttctgacggtcgtttt
gtggtgaggtctgaaaggatggaaagaaaagcactacagctgtatcaccagagagtgtct
aagattgcagaagacattcagtcagaacatggagaacactgcgacaacactgatgataac
gatgaaggggcaaaaatatgcaaaatgctagagagggcagctgagcctgaaattcttatg
tccagcatgagttcagagcagctgctgtctttctcatattatcaagaaaagcaaaagatt
gtcaggcaaaatgaagtagctaagaaggttgaaaatgctcttaaagttgctgggcttagt
tcaagagatgttacaccatttttgaaagtgagggtgacgggccttatcagcaaacactcc
gccacaaaatctggctgcagggaagggttaataacaatttggaaccctaccgagaagcaa
aaatccgacctggtggagggacaaatttattctgtcacaggactgttggcttcaagctac
tttacagaagtatcctacttgagtggtagaggatcatctacagcatggacgcctttagca
accgcacagactacaaattttgaaccatttttcacccctcgtaaagcagttgaattgtca
cattttggtgaagtgccacttacaagcgaatttgacattgcaggtgttattttgtatgtt
gggaatgtttatttattgaacaaccagaataggcagtggctctttttgacagatggatct
aaatttatctctggagaaaagtatgaagagcaagatgactgtcttctggcagttagcttt
tcttccaaaaccactggcgaggattctgcattcttcaattatgccctttctggacatata
gttggttttagtaatctggtcaagcgagataaagaccagatgaggcacgtgtgggtagct
gaggcgacagagagctccacctatagtctctcccacgagatacctaaaaaatcacatctc
aaagaggctgccacttctgctgaaaaatgggcttcaaattctcatcctatgattcagcat
ctgaaggaaagagttctgcaaatagttggtgacagtggtggctga

DBGET integrated database retrieval system