KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324423
Entry
4324423           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4324423
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4324423
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4324423
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4324423
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4324423
NCBI-ProteinID: XP_015621200
UniProt: A0A0P0V7R6 Q7F6J7
LinkDB
Position
1:30459902..30464461
AA seq 878 aa
MFSRSYTNLVDLANGNLSALDYGGGGGGGGGGNGAGGRPPRARRMQRTMTTPGTLAELDE
ERAGSVTSDVPSSLASDRLIVVANTLPVRCERRPDGRGWSFCWDEDSLLLHLRDGLPDDM
EVLYVGSLRADVPSAEQDDVAQALLDRFRCVPAFLPKDVLDRFYHGFCKQTLWPLFHYML
PFTSDHGGRFDRSQWEAYVLANKLFSQRVIEVLNPEDDYIWIHDYHLLALPSFLRRRFNR
LRIGFFLHSPFPSSELYRSLPVRDEILKSLLNCDLIGFHTFDYARHFLSCCSRMLGIEYQ
SKRGYIGLDYFGRTVGIKIMPVGINMTQLQTQIRLPDLEWRVAELRKQFDGKTVMLGVDD
MDIFKGINLKVLAFEQMLRTHPKWQRKAVLVQIANPRGGGGKDLEEIQAEIDESCRRINA
QFSRPGYVPVVIINRALSSVERMAYYTVAECVVVTAVRDGMNLTPYEYIVCRQGFPDLDG
SGDDGPRRKSMLVVSEFIGCSPSLSGAIRVNPWNIDTTAEAMNESIALSENEKQLRHEKH
YRYVSSHDVAYWSKSYIHDLERSCRDHFRRRCWGIGLGFGFRVVALDRNFKKLTVDSIVT
DYKNSKSRVILLDYDGTLVPQTTINRTPNESVVKIMNALCDDKKNVVFIVSGRGRDSLEK
WFSPCQDLGIAAEHGYFMRWTRDEQWQLNNQCSEFGWMQMAKPVMNLYTEATDGSYIETK
ESALVWHHQDADPGFGSSQAKEMLDHLESVLANEPVCVKSGQQIVEVKPQGVSKGFVAEK
ILSTLTENKRQADFVLCIGDDRSDEDMFEGIADIMRRSIVDPQTSLYACTVGQKPSKAKY
YLDDTNDVLNMLEALADASEETDSQEDAEEITSIPDPE
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgttctcgcgatcctacaccaacctggtcgatctcgccaacggcaacctctccgccctg
gactatggtggcggagggggagggggcggcggcggcaacggggccgggggccggccgccg
cgggcgaggcggatgcagcggacgatgacgacgcccgggacgctggcggagctcgacgag
gagcgggccgggagcgtcacctccgacgtgccctcgtcgctcgccagcgaccgcctcatc
gtcgtcgccaacaccctccccgtgcgctgcgagcgccgccccgacgggcgcgggtggagc
ttctgctgggacgaggactccctcctcctccacctccgcgacggcctccccgatgacatg
gaggtcctctacgtcggctccctccgcgccgacgtgccgtccgccgagcaggacgacgtc
gcgcaggcgctcctcgaccggttccgctgcgtcccggctttcctccccaaggacgtcttg
gacagattctaccatggcttctgcaagcagacgctgtggccgctcttccactacatgctc
cccttcacctccgaccatggcggccgcttcgatcgctcccagtgggaggcatacgtcctc
gccaacaagctcttctcccagcgcgtcatcgaggtcctcaaccccgaggatgactacatc
tggatccacgattaccacctcctcgccctcccgtccttccttcgccgtcggttcaacagg
ctccgcatcggtttcttcctgcacagcccgttcccttcgtcggaactctaccgttccctc
cctgttcgcgacgagatcctcaaatcactgctaaactgcgatctgattgggttccacacc
tttgattacgcgcggcatttcctgtcctgctgcagccggatgctggggatcgagtaccag
tcgaagaggggatatatcggtctcgattactttggccgcactgttgggataaagatcatg
cctgttgggattaacatgacgcagctgcagacgcagatccggctgcctgatcttgagtgg
cgtgtcgccgaactccggaagcagtttgatgggaagactgtcatgctcggtgtggatgat
atggacatatttaaggggattaatctgaaagttcttgcgtttgagcagatgctgaggaca
cacccaaaatggcagcgcaaggcagtgttggtgcagattgcaaacccaaggggtggtggt
gggaaggaccttgaagagatacaggctgagattgatgagagttgcaggaggataaatgca
caattttcacggccaggatatgttcctgtggtgattatcaatagagccctttcaagtgtg
gagaggatggcttattataccgtggcagagtgtgtcgttgtaactgcagtgagggatggg
atgaacctcacaccatatgagtatattgtctgtagacagggatttccagatttggatggt
tctggggatgatgggccaaggagaaagagtatgttagttgtgtccgaattcattggttgc
tcaccatcacttagtggagcaattcgggtaaacccttggaacattgatacaacagcagag
gcaatgaacgagtcgattgctttatcagagaacgagaagcaactgcggcatgagaagcat
tacagatatgtcagctcacatgatgttgcctattggtccaagagctatattcatgatttg
gagagaagctgcagggaccattttaggaggaggtgctggggtattggactaggatttgga
tttagagtagttgctcttgaccgcaacttcaaaaagcttactgtggattctatcgttact
gattacaagaattctaagagcagggttatactgctagactacgatggaacgctagtacca
caaactacaatcaacaggactccaaatgaaagtgttgttaaaatcatgaatgctctttgt
gacgataagaagaatgttgtttttattgttagtggacgaggaagggatagccttgagaaa
tggttttccccttgccaggatcttggcattgctgccgaacatggctactttatgaggtgg
accagagatgagcaatggcaattgaataaccagtgctcagaatttggatggatgcagatg
gccaagccagttatgaacctgtatacagaagcaaccgatggatcatatattgaaaccaaa
gagagtgctttggtctggcaccaccaagatgctgaccctggttttggatcttcacaagct
aaagagatgctagatcatttggaaagtgttcttgctaatgagcctgtctgtgtaaagagt
ggccaacagattgtggaagtgaaaccgcagggtgtcagcaaaggatttgttgctgagaag
atcctatcaacgctgacagagaacaagagacaggcagattttgttctctgcataggcgat
gatagatcagacgaggatatgtttgaaggaattgctgatatcatgagaaggagcatagtt
gatccccaaacatcattatatgcgtgcacagtcggccagaagccaagcaaggctaagtac
tatttggacgatactaatgatgttttgaacatgcttgaggcgcttgcagatgcatcagag
gagactgattcacaggaagatgcagaagagataacatctatcccggacccggaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324621
Entry
4324621           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4324621
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4324621
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4324621
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4324621
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4324621
NCBI-ProteinID: XP_015647552
UniProt: Q5JNJ1 B9EZN8
LinkDB
Position
1:complement(31373446..31377544)
AA seq 913 aa
MMSRSYTNLLDLAEGNFAALGPGGGGGGRRRSGSFGLKRMSRVMTVPGTLSELDGEDDSE
HAATNSVASDVPSSVAGDRVIVVSNQLPVVARRRPDGRGWSFSWDDDSLLLQLRDGIPDE
MEVFFVGSLRAEIPVADQEEVSQALLDRFRCAPVFLPDPLNERFYHRFCKRHLWPLFHYM
LPFSSSASPSPSSSSSSSSSPSSSSGSGHFDRGAWEAYVLANKFFFEKVVEVINPEDDYV
WVHDYHLMALPTFLRRRFNRLRIGFFLHSPFPSSEIYRTLPVREEILKALLNCDLIGFHT
FDYARHFLSCCSRMLGIEYQSKRGYIGLDYFGRTVGIKIMPVGVHMGQLKTVLSLPDREW
RVSELQQQFEGKTVLLGVDDMDIFKGINLKLLAFENMLRTHPKWQGRAVLVQIANPARGK
GKDLEAIQAEIHESCKRINGEFGQSGYSPVVFIDRDVSSVEKIAYYTIAECVVVTAVRDG
MNLTPYEYIVCRQGSDSTSEVNGPKKSMLVVSEFIGCSPSLSGAIRVNPWNIEATAEALN
EAISMSEQEKHLRHEKHYRYVSTHDVAYWSKSFIQDLERACKDHFRRTCWGIGLGFGFRV
VALDPHFTKLNMDSIVMAYERSESRAIFLDYDGTLVPQTSISRTPSAEVLRIINTLCSDR
RNKVFLVSGRRRDKLGEWFSSCPDLGIAAEHGYFLRWTRDEEWQTCTQTSDFGWMEMAKP
VMNLYTEATDGSYIDPKESALVWHHQDADPGFGSSQAKELLDHLESVLANEPVSVKSGQF
IVEVKPQGVSKGVVAEKILVSMKERGKQADFVLCIGDDRSDEDMFENIADTIKKGMVATN
TSLFACTVGQKPSKAKFYLDDTFEVVTMLSALADATEPEPETDLTDEFDELAVSVSSVDI
DDEQTPSDKLIGG
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgatgtcgcggtcgtacaccaaccttctcgatctcgcggaggggaacttcgcggcgttg
ggcccgggaggcggcggcggcgggaggcggaggtcggggtcgttcgggctgaagcggatg
tcgcgggtgatgacggtgcccgggacgctgtcggagctggacggggaggacgactcggag
cacgcggcgacgaacagcgtcgcctccgacgtgccctcgtcggtggcgggggatcgagtc
atagtggtctccaaccagctgcccgtcgtcgcacgccgccgtcccgacggccgcgggtgg
tccttctcatgggacgacgactcgctgctcctccagctccgcgacggcattcccgatgag
atggaggtgttcttcgtcggttccctccgcgccgaaatccccgtcgccgaccaggaagag
gtctcccaggcgctgctcgatcgcttccgatgtgctccggtgttcctccccgaccccctc
aacgaacggttttaccaccgcttctgcaagcgccacctatggcctctgttccactacatg
ctccctttctcctcctccgcatccccgagtccctcctcctcctcctcctcctcctcctcc
ccctcatcctcatccggcagtggccacttcgaccgcggcgcgtgggaggcctacgtgctc
gcgaacaagttcttcttcgagaaggtcgtggaggtcatcaacccagaagacgactacgta
tgggttcacgactaccatctcatggcgctgcccaccttccttcgccgccgcttcaaccgc
ctgcgcatcggcttcttcctccacagccccttcccctcgtcggagatctaccggaccctc
cctgttcgcgaggagatcctaaaggcgctgctcaattgtgaccttattggattccacact
tttgactatgccagacatttcctctcttgttgtagtaggatgctgggaattgaataccag
tcaaagcgtggatacattgggttggattactttgggcgtaccgttgggatcaaaatcatg
ccagtgggagttcatatgggtcaattgaagacggttctgagcttgcccgacagggaatgg
agggtctccgagctgcagcagcaatttgaggggaagactgtgttgctcggtgtggatgac
atggatatcttcaagggtatcaacttgaagcttcttgccttcgagaatatgttgaggaca
catcccaagtggcaggggcgggcagtgttggtgcaaattgctaatccggcccgtggaaag
ggtaaggatcttgaagccatccaggctgagattcatgagagctgcaagaggattaatgga
gagtttggccagtcaggatacagccctgttgtcttcattgaccgtgatgtgtcaagtgtg
gagaagattgcctactacacaatagcagaatgtgtggtggtgactgctgtgagggatggg
atgaacttgacaccatatgaatatattgtctgtaggcaggggtctgactccacatcagaa
gtgaatggaccaaagaagagcatgctggtggtatcagaattcattgggtgctcaccatct
ctgagtggtgctatccgggttaacccatggaatatagaggcaaccgcagaggcactgaat
gaggccatatcaatgtcggaacaggagaaacacctaaggcatgagaaacattaccgttat
gtcagcacccacgatgttgcttattggtcgaaaagtttcatccaagatttggagagggct
tgcaaggaccacttcaggaggacatgttggggcatcgggttggggtttggttttagggtg
gtggccttagatccccatttcacaaagcttaacatggattcaattgttatggcttatgag
cggtcagagagtagggctatatttcttgattatgatggaacactggtgccacagacttcc
atcagtaggacacctagtgcggaagttttgaggatcatcaataccctgtgctcagatagg
aggaacaaagtttttcttgtcagtgggagacgcagggacaaattgggagaatggttttcc
tcttgtccagatctgggcattgcagcagagcatggttacttcttaaggtggactagagac
gaagagtggcaaacatgtacccagacctctgacttcgggtggatggaaatggccaagcca
gtgatgaatctgtatacagaagcaactgatggatcttacattgatcctaaggaaagtgct
ttggtgtggcatcaccaggatgctgacccaggatttggatcctcccaggcaaaggagtta
cttgatcatctggaaagtgtattagcaaatgaacctgtttctgtcaaaagtggccagttc
attgttgaagtcaaacctcagggagtaagcaagggagtagtagctgagaagatactcgtc
tcaatgaaggagagaggaaagcaggctgactttgtattatgcattggtgatgacaggtcg
gatgaggacatgtttgaaaacattgctgataccattaaaaagggtatggttgctacaaac
acatcattgtttgcatgcactgtgggacaaaaaccaagcaaggccaaattttacctggat
gatacgtttgaagtggtcaccatgctgagcgcactggcagatgctactgaaccagaacct
gagactgatcttaccgatgagtttgatgaactggccgtgtctgtctcctcagttgatatt
gatgatgaacaaacgcccagtgataaactgatcggaggatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330971
Entry
4330971           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330971
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4330971
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4330971
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4330971
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4330971
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4330971
NCBI-ProteinID: XP_015625782
UniProt: A3AC56
LinkDB
Position
2:33569238..33573166
AA seq 847 aa
MPSLSCHNLLDLVAAADDAAPSPASLRLPRVMSAASPASPTSPSTPAPARRVVVSHRLPL
RAAADAASPFGFSFTVDSDAVAYQLRSGLPPGAPVLHIGTLPPPATEAASDELCNYLLAN
FSCLPVYLPADLHRRFYHGFCKHYLWPLLHYLLPLTPSSLGGLPFDRALYHSFLSANRAF
ADRLTEVLSPDDDLVWIHDYHLLALPTFLRKRFPRAKVGFFLHSPFPSSEIFRTIPVRED
LLRALLNADLVGFHTFDYARHFLSACSRLLGLDYQSKRGYIGIEYYGRTVTVKILPVGID
MGQLRSVVSAPETGDLVRRLTESYKGRRLMVGVDDVDLFKGIGLKFLAMEQLLVEHPELR
GRAVLVQIANPARSEGRDIQEVQGEARAISARVNARFGTPGYTPIVLIDRGVSVHEKAAY
YAAAECCVVSAVRDGLNRIPYIYTVCRQESTGLDDAAKRSVIVLSEFVGCSPSLSGAIRV
NPWSVESMAEAMNAALRMPEPEQRLRHEKHYKYVSTHDVAYWAKSFDQDLQRACKDHFSR
RHWGIGFGMSFKVVALGPNFRRLSVDHIVPSYRKSDNRLILLDYDGTVMPEGSIDKAPSN
EVISVLNRLCEDPKNRVFIVSGRGKDELGRWFAPCEKLGIAAEHGYFTRWSRDSAWETCG
LAVDFDWKKTAEPVMRLYKEATDGSTIEDKESALVWHHDEADPDFGSCQAKELLDHLENV
LANEPVVVKRGQHIVEVNPQGISKGVVVDNLLSSMVSRGKAPDFVLCIGDDRSDEDMFES
IVCPSNSSVKLPASSEVFACTVGKKPSMAKYYLDDTVDVIKMLQGLANAPSQRPRQVQLR
VSFEGSL
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgccttcgctctcctgccacaacctcctcgacctcgttgccgcggcggacgacgcggcg
ccgtcgcccgcgtcgctgcgcctcccgcgcgtcatgtcggcggcgtcgccggcctcgccc
acgtcgccgtccacgccggcccccgcgcggagggtggtcgtgtcgcaccgcctcccgctc
cgcgccgcggccgacgcggcgtcgccgttcgggttctccttcacggttgactcggacgcc
gtcgcgtaccagctccgctcggggctgccccccggcgcgcccgtcctccacatcggcacg
ctcccgccgcccgcaaccgaggcggcctccgacgagctctgcaactacttgctggcgaac
ttctcttgcctgccggtgtacttgcccgccgatctccaccgccgattctaccatggattc
tgcaagcactacctgtggcctctcctccattaccttctgccgctcacgccgtcgtcgctg
ggcgggttgccgttcgaccgcgcgctctaccattctttcctctcggcgaaccgggccttc
gccgaccgcctcaccgaggtgctcagccccgacgacgacctcgtctggatccacgattac
cacctccttgccctccccaccttcctccgcaagcgattcccgcgcgccaaggtcggtttc
ttcctccactcgccgttcccctcctcggagatcttccgcaccattcccgtcagggaggac
ctcctccgcgccctcctcaacgccgacctcgtcggcttccacaccttcgactacgcgcgc
cacttcctctccgcctgctcgcggctgctcggcctggattaccagtccaagcgcggctac
atcggcatcgagtactatggtcgcaccgtcacggtcaagattctgcccgtcgggatcgac
atgggccagctgaggtcggtggtgtcggcgccggagacgggggacctggtgcggcggctc
accgagtcgtacaaggggcggcgcctgatggtcggcgtcgacgacgtcgacctgttcaag
ggaatcgggctcaagttcctggcgatggagcagctgctggtggagcacccggagctgcgc
ggccgcgcggtgctcgtgcagatcgcgaacccggcgcgcagcgaggggcgcgacatccag
gaggttcagggagaagccagggcgatcagcgcccgcgtcaatgcgcggttcggcacgccg
gggtacacccctatcgtgctgatcgaccgcggtgtgtcggtgcacgagaaggcggcgtac
tacgcggcggccgagtgctgcgtggtgagcgccgtgcgggacggcctcaaccggataccc
tacatctacacggtgtgccggcaggagagcactggcctggatgatgcggccaagcgcagc
gtcattgtgctgtcggagttcgtcgggtgctccccgtcgctcagcggcgcaatccgggtc
aacccatggagtgtggagtctatggcagaggccatgaatgcagccctgaggatgcctgag
ccagagcagcggctgcgacatgagaagcactacaagtatgtgagcacccatgatgttgcc
tactgggcgaaatctttcgaccaggacctgcagcgagcttgcaaggatcatttctcgcgg
cggcattggggtattgggtttgggatgagtttcaaggtggtggcacttggcccgaatttc
aggcggctgtctgtcgatcacattgtgccgtcataccggaagtctgataatcgcttaatt
ctcttggactatgatggcacagtgatgccagagggttcaattgataaggcaccgagcaat
gaggtcatctctgtattgaatcgtctgtgcgaggaccccaagaacagagtgttcatcgtg
agcggtagagggaaggatgaacttggcagatggtttgcaccttgtgagaagctggggatt
gctgcagagcatggttacttcacaaggtggagcagggactcagcttgggagacctgcggg
ttggccgtggactttgattggaagaagactgcagaaccagtgatgaggctttacaaggag
gcaacagatggttcaaccatcgaagacaaggaaagcgcgttagtttggcaccacgatgag
gcagatccagattttggttcatgccaggcaaaggaactgcttgaccacctcgaaaacgtt
cttgcaaatgaaccagtcgttgttaagaggggccagcatatcgtcgaagtaaatccacag
ggcatcagcaaaggtgtggttgtggacaacctcttgtcatccatggtgagccgagggaag
gcgcccgatttcgtgctgtgcattggggacgaccggtcggacgaggacatgttcgagagc
atcgtttgcccgtcgaacagcagcgtcaagctcccggcgagcagcgaggtgttcgcctgc
acggtcggcaagaagccgagcatggccaagtactacctcgacgacacggtcgacgtgatc
aagatgctgcagggtctcgccaatgcgccatcgcagcggccaaggcaagtgcagctgcgg
gtctcgttcgaaggctcactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332112
Entry
4332112           CDS       T01015                                 
Name
(RefSeq) alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4332112
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4332112
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4332112
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4332112
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4332112
NCBI-ProteinID: XP_015630576
UniProt: Q10PR5 Q8H7S6
LinkDB
Position
3:complement(6519054..6523482)
AA seq 860 aa
MVSRSYSNLLDLATGAADQAPAPAALGALRRRLPRVVTTAGLIDDSPLSPSTPSPSPRPR
TIVVANHLPIRAHRPASPSEPWTFSWDEDSLLRHLQHSSSSPAMEFIYIGCLRDDIPLAD
QDAVAQALLESYNCVPAFLPPDIAERYYHGFCKQHLWPLFHYMLPLSPDLGGRFDRALWQ
SYVSANKIFADKVLEVINPDDDFVWVHDYHLMVLPTFLRKRFNRIKLGFFLHSPFPSSEI
YKTLPVREELLRALLNSDLIGFHTFDYARHFLSCCGRMLGLSYESKRGHICLEYYGRTVS
IKILPVGVNMGQLKTVLALPETEAKVAELMATYSGKGRVVMLGVDDMDIFKGISLKLLAM
EELLRQHPEWRGKLVLVQVANPARGRGKDVDEVKGETYAMVRRINEAYGAPGYEPVVLID
EPLQFYERVAYYVVAEVCLVTAVRDGMNLIPYEYIVSRQGNEALDRMLQPSKPEEKKSML
VVSEFIGCSPSLSGAVRVNPWNIEAVADAMESALVLPEKEKRMRHDKHYRYVDTHDVGYW
ATSFLQDLERTCKDHAQRRCWGIGFGLRFRVVSLDLSFRKLAMEHIVMAYRRAKTRAILL
DYDGTLMPQAINKSPSANSVETLTSLCRDKSNKVFLCSGFEKGTLHDWFPCENLGLAAEH
GYFLRSSRDAEWEISIPPADCSWKQIAEPVMCLYRETTDGSIIENRETVLVWNYEDADPD
FGSCQAKELVDHLESVLANEPVSVKSTGHSVEVKPQGVSKGLVARRLLASMQERGMCTDF
VLCIGDDRSDEEMFQMITSSTCGESLAATAEVFACTVGRKPSKAKYYLDDTAEVVRLMQG
LASVSNELARAASPPEDDDE
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggtttctcggtcctactccaacctgctggacctggccaccggcgcggcggaccaggcg
ccggcgccggcggcgctcggcgcgctccggcggcggctgccgcgggtggtgaccaccgcg
gggctcatcgacgactccccgctgtccccctcgacgccgtccccgtcgccgcggccgcgc
accatcgtggtcgccaaccacctccctatccgggctcaccgcccggcgtcgccgtcggag
ccgtggaccttctcctgggacgaggactccctcctccgccacctccagcactcgtcctcc
tcccccgccatggagttcatctacatcggctgcctccgcgacgacatcccgctggccgac
caggacgccgtcgcgcaggcgctcctcgagtcgtacaactgcgtgccggcgttcctgccc
cccgacatcgccgagcgctactaccatggcttctgcaagcagcatctgtggccgctgttc
cactacatgctgccgctctcccccgacctcggcggccgcttcgaccgcgcgctgtggcag
tcgtacgtgtcggcgaacaagatcttcgcggacaaggtgctcgaggtgatcaacccggac
gacgacttcgtgtgggtgcacgactaccacctcatggtgctcccaaccttcctccgcaag
cgcttcaaccgcatcaagctcggcttcttcctccactcgccgttcccctcgtcggagatc
tacaagacgctccccgtccgggaggagctcctgcgcgcgctgctcaactccgacctcatc
ggcttccacaccttcgactacgcgcgccacttcctctcctgctgcggccggatgctgggg
ctctcctacgagtccaagcgtggccacatctgcttggagtactacggccggacggtgagc
atcaagatcctcccggtgggggtgaacatggggcagctcaagacggtgctcgcgttgccg
gagacggaggcgaaggtggcagagctgatggcgacttactccgggaaggggagggtcgtc
atgctgggcgtcgacgacatggacatcttcaaggggatcagcctcaagctgctcgccatg
gaggagctgctgcggcagcaccccgagtggcgcggcaagctggtgctcgtccaggtcgcg
aacccggcgcgcggccgcggcaaggacgtcgacgaggtgaagggggagacgtacgccatg
gtgcggcggatcaacgaggcgtacggcgcgcccgggtacgagccggtggtgctcatcgac
gagccgctccagttctacgagcgcgtggcgtactacgtcgtcgccgaggtgtgcctggtg
accgcggtccgcgacggcatgaacctgatcccctacgagtacatcgtgtccaggcagggc
aacgaggcgctcgacaggatgctgcagccgagcaagccggaggagaagaagagcatgctg
gtggtgtccgagttcatcgggtgctcgccgtcgctgagcggcgcggtgagggtgaacccg
tggaacatcgaggccgtggcggacgccatggagagcgcgctcgtgctgccggagaaggag
aagcggatgcgccacgacaagcactaccgctacgtggacacccacgacgtgggctactgg
gcgaccagcttcctgcaggacctcgagaggacgtgcaaggatcacgcgcagcggcggtgc
tggggcatcggcttcgggctgcggttcagggtggtgtcgcttgacctcagcttcaggaag
ctcgccatggagcacattgtcatggcgtaccggagggcgaagacgcgcgccatcctgctc
gactacgacggcacgctcatgccgcaggcgatcaacaagagcccgagcgccaattccgtc
gaaacgctgaccagcttgtgcagggacaagagcaacaaggttttcctctgcagcgggttc
gagaagggaacactccatgactggttcccctgcgagaaccttggcttggcggctgagcac
ggttacttcctgaggtcatcgagggatgcagagtgggagatttccattccccccgcggac
tgcagctggaagcagatcgcggagccggtgatgtgcctgtacagggagaccacggacggc
tcgatcatcgagaacagggagacggtgctcgtctggaactacgaggacgcagaccctgac
ttcggttcatgccaagccaaggagctcgtcgaccacctcgagagcgtgctcgccaacgag
cccgtctcggtgaagagcaccggccattccgttgaggtcaagccacagggcgtgagcaag
ggcctggtggcgcggcggctgctggcgagcatgcaggagaggggcatgtgcaccgacttc
gtgctgtgcatcggggacgaccgctccgacgaggaaatgttccagatgatcacaagctcc
acctgcggcgagtcgctggcggccacggcggaggtcttcgcctgcaccgtcggccgcaag
ccgagcaaggccaagtactacctcgacgacacggcggaggtcgtcaggctgatgcagggc
ttggcctccgtctccaacgagctggctcgggcggcgagccccccggaggacgacgacgaa
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339327
Entry
4339327           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4339327
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4339327
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4339327
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4339327
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4339327
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4339327
NCBI-ProteinID: XP_015640013
UniProt: A0A0P0WPQ7 Q75II7
LinkDB
Position
5:25641603..25646405
AA seq 899 aa
MMSRSYTNLLDLAAGNFEALGPAGGGRRRSFGAKRMTRVMTVPGTLSELDDEDDEPAATS
SVASDVPSSAACERLIVVANQLPVVARRRPGAAAGGWAFSWDDDSLLLRLRDGVPDEMEV
LFIGTLRADVPACEQDEVSQSLIDGFGCAPVFLPAGLYDRFYQHFCKGYLWPLFHYMLPF
ASALPAAASGDGRFDRGAWEAYVLANKYFFEKVVEVINPEDDYVWVHDYHLMALPTFLRR
RFNRLRIGFFLHSPFPSSEIYRSLPVREEILRTLLNCDLIGFHTFDYARHFLSCCSRMLG
IEYQSKRGYIGLDYFGRTVGIKIMPVGIHMGQLQSVLRLSEKEKKVAELRQQFEGKSVLL
GVDDMDIFKGINLKLLAFENMLRTHPKWKGRAVLVQIANPARGKGKDLEAVQAEIRESCD
RINKEFGQSGYSPVIFIDQSVPSAVRLAYYTVAECVVVTAVRDGMNLTPYEYIVCREGIP
GSECAPEVSGPKKSMLVVSEFIGCSPSLSGAIRVNPWNIEATAEALNEAISMSEREKQLR
HEKHYRYVSTHDVAYWSKSFVQDLERACKDHFRKPCWGIGLGFGFRVVALDPHFTKLNFD
SIIMSYERSKSRAIFLDYDGTLVPQASLNKNPSEELLRIINTLCADRNNTVFIVSGRSKD
DLSKKLISCPKLGIAAEHGYFLRWTRDEEWQTTAQTSDFGWMQMAKPVMDLYTESTDGST
IETKETALVWHHQDADQGFGSSQAKEMLDHLESVLANEPVSVKSGQFIVEVKPQGVTKGL
IAEKVLTSMKEKGQLADFVLCIGDDRSDEDMFENIADVMKRSIVAPKTPLFACTVGQKPS
KARFYLDDTFEVVTMLSSLADASEPDLMADLEDDLATSVSSIEISDRVVSFSNLRTEGS
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgatgtcgaggtcgtacacgaacctgctggacctcgcggcggggaacttcgaggcgctg
gggccggcggggggagggaggaggaggtcgttcggggcgaagcggatgacgcgggtgatg
acggtgcccgggacgctgtcggagctggacgacgaggacgacgagccggcggcgacgagc
agcgtcgcctccgacgtgccctcgtcggcggcgtgcgagcgcctcatcgtcgtggcgaac
cagctccccgtggtggcgcggcggaggccgggcgccgcggcgggggggtgggcgttctcg
tgggacgacgactcgctcctcctccgcctccgcgacggcgtccccgacgagatggaggtg
ctcttcatcggcacgctccgcgccgacgtgcccgcctgcgagcaggacgaggtgtcgcag
agcctcatcgatggattcggatgcgcacccgtgttcctccccgcggggctctacgaccga
ttctaccagcacttctgcaagggttacctatggccgctgttccactacatgctccccttc
gcctccgccttgccggcggccgcatccggcgatggccggtttgaccgcggcgcgtgggag
gcctacgtgctcgccaacaaatacttcttcgagaaggtggtcgaggtcatcaacccggag
gacgactacgtttgggtccacgattaccacctcatggcgctgcccaccttcctccgccgc
cgcttcaatcgcctccgcatcgggttcttcctccacagcccctttccctcatcggagatc
taccgctcgctgcccgtccgagaggagatcctaagaacgctgcttaattgcgatctcatt
ggattccacacattcgattatgcgaggcacttcctatcttgctgtagtaggatgctgggg
atagagtaccagtcaaagcgtggatacattggattggattactttggccgcactgttgga
atcaagatcatgccagtgggaatccatatgggtcaattgcaatcagtgttgcgattgtcc
gagaaagaaaagaaggttgctgagctgcggcagcaattcgagggcaagtccgtgttactt
ggtgtggatgatatggatatcttcaagggaatcaacttaaaacttcttgcgtttgagaat
atgctgaggacgcatcccaagtggaagggaagagctgtgttggtgcagattgcaaaccca
gcacgagggaagggaaaggatctggaggctgtccaggctgagattcgggagagttgtgat
agaattaacaaggagtttggccagtcaggttacagtccagtgattttcattgaccagagc
gtgccaagtgcggtgaggcttgcatattatacggttgctgagtgtgttgtggtgacggct
gtgagggatgggatgaatttgaccccatatgaatacattgtctgccgggaggggatacct
ggctctgagtgtgcaccagaggtgagtggaccaaagaagagcatgttggttgtgtcggag
tttattggttgctcaccttcactgagtggagccattcgtgttaacccgtggaatatcgag
gcaactgcagaggcactgaatgaggccatctcaatgtcagagcgtgaaaagcagctgagg
cacgaaaaacattaccgttatgtcagcacccatgatgttgcatattggtctaagagcttt
gtacaggacctggagagggcttgcaaggatcactttaggaaaccatgctggggcattgga
ttgggatttggcttcagggtggtagccctagacccacatttcacaaagcttaatttcgat
tcaattataatgtcctatgagagatcaaagagtagggctatatttctcgactatgatggc
acattggtgccacaggcttcgctcaacaagaatccaagtgaagaattactgaggatcatt
aataccctatgcgcagatagaaataacaccgtgttcattgtcagcgggagaagcaaggat
gacttgagcaaaaagcttatctcatgtccaaagctaggcattgccgcagagcatggctac
ttcttaaggtggactagagatgaagaatggcaaaccactgcacagacctcagattttgga
tggatgcaaatggcgaagccagtgatggatctttatactgaatcaactgacggatccacc
attgagactaaagaaactgcactggtgtggcaccatcaggatgctgaccaaggttttggc
tcttcccaggcaaaggaaatgcttgatcacttggaaagtgtattagcaaatgaaccagtc
tcagtcaagagtggccaattcattgttgaagtcaaacctcagggtgttaccaaagggctc
atagctgagaaagtactcacatcaatgaaggagaaggggcaactggcagattttgtatta
tgcattggtgatgacaggtcagatgaggatatgtttgaaaatattgccgatgtcatgaaa
aggagcattgttgcaccaaaaactccactgtttgcatgtactgtgggccagaagccaagc
aaagctaggttttacctggatgatacatttgaagtcgtcaccatgttgagttcactggcg
gatgcttcagaaccagaccttatggcagacttggaagatgacttggccacatcagtctca
tcaatagaaataagtgacagagtggtatcttttagtaatttaaggacagaaggatcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345573
Entry
4345573           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4345573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4345573
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4345573
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4345573
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4345573
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4345573
NCBI-ProteinID: XP_015649990
UniProt: A0A0P0XG00 Q6Z548
LinkDB
Position
8:complement(19830418..19836143)
AA seq 862 aa
MVSKSYSNLLEMSCGDGVDFRQPFKSLPRVVTSPGIISDPDWDTRSDGDSVGSASSVERK
IIVANFLPLNCTKDEAGQWSFSRDDDALLMQLKDGFSNETDVIYVGSLKVQVDPSEQDQV
AQKLLRDYRCIPTFLPPDLQQQFYHGFCKQQLWPLFHYMLPICLDKGELFDRSLFQAYVR
ANKLFADKVMEAINTDDDHVWVHDYHLMLLPTFLRKRLHRIKLGFFLHSPFPSSEIYRSL
PVRDEILKSLLNADLIGFQTFDYARHFLSCCSRLLGLHYESKRGYIGIDYFGRTVSLKIL
SVGVHVGRLESILKLPATVKKVQEIEQRYKGKMLMLGVDDMDIFKGISLKLLGLELLLDR
NPKLRGKVVLVQIVNPARSTGKDVEEAITESVSVAERINLKYGSVDYKPVVLIDHRIPFY
EKIAFYAASDCCIVNALRDGMNLVPYEYTVCRQGNEEIDNARGSDTNCHHTSTLIVSEFV
GCSPSLSGAFRVNPWSVDDVADALHHATDLTESEKRLRHEKHYRYVRSHSVAYWAHSFAQ
DLERACKDHYSRRCWAIGFGLNFRVIALSPGFRKLSLEHFASSYNKATRRAIFLDYDGTL
VPQSSINKAPSDELITILNSLCDDPKNDVFIVSGRARSLLDEWFAPCQKLGIAAEHGYFV
RWNKAAEWESSYPNHDFEWKHIAEPVMQVYTETTDGSSIEPKESALVWHYLDADHDFGSC
QAKELLGHLERVLSNEPVVVKCGHYIVEVKPQGVSKGLVVDKVIHRLMNNGKTPDFVVCI
GNDRSDEDMFKSIDSMTSSSAFPAVPEVFACSVGQKPSKAKYYVDDAGEVVRLLKNVAGI
SSHREAVSHGRVTFRDVMDYVE
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggtttcaaaatcttattcaaatctgttagaaatgagttgtggagatggagttgacttt
cggcaaccttttaaatctcttcctcgtgtggtaacctctcctggcattatatctgatcct
gattgggacactagaagtgatggcgattcagttggttcagcatcttctgttgagaggaaa
ataattgttgccaacttccttccactgaactgtacaaaagatgaagctgggcaatggtcc
ttctcaagggatgatgatgcactgctcatgcaacttaaagatggtttttcaaatgagact
gatgtcatttatgtgggtagtttgaaggttcaggtagatcccagtgagcaggatcaagtt
gcacagaagcttcttagagattaccgatgcatacctacttttctccctcctgacctccag
cagcagttctatcatggcttctgtaaacagcaattgtggccacttttccactatatgctt
cccatttgtcttgacaaaggtgagctctttgatcgctccctgtttcaagcctatgtccga
gctaacaaactctttgccgacaaagttatggaagctattaatacggatgatgatcatgtc
tgggttcatgattatcacctcatgcttctcccaacatttctgaggaagaggttacaccga
ataaagctaggattttttctccacagtccatttccctcctcagaaatctacaggtcactg
cctgtaagggatgagatcctgaagtcattgcttaatgctgatcttattggtttccaaaca
tttgactatgcccgccacttcctttcttgttgcagcagattattgggtctgcattatgaa
tcaaagcgcggttacattggaatagattactttggaagaacagtgagcctgaagatcctc
tcagtgggtgtccatgttggccgtcttgagtccatcctaaagttgcctgctacagtaaag
aaggttcaagaaattgaacaaaggtataaaggcaagatgctcatgttaggtgtagatgac
atggacatcttcaaaggaatcagtctaaaactgcttgggttggagctacttctagatagg
aacccgaaactcagagggaaggttgtccttgtacagattgtcaatccagcaagaagcaca
gggaaagacgtggaggaagcaataacagaatctgtctctgtagctgaaagaatcaacctt
aagtatggctctgtagattacaagcctgttgtccttattgatcatcgcataccattttat
gaaaagattgcattctatgctgcatctgattgttgtattgtaaatgctctgagggatggt
atgaacttggtaccatatgagtacactgtttgccggcagggaaatgaggagatagataat
gccagaggcagtgacacaaattgccatcacacaagcacactaattgtgtctgagtttgtt
ggttgctcaccatctcttagtggtgctttcagggtaaatccttggagtgttgacgatgtg
gctgatgccttacaccatgcaacagacttgactgaatccgagaaaaggctacggcatgaa
aagcactaccgttatgttagatctcatagtgttgcttactgggctcatagctttgctcaa
gatctggaaagggcatgcaaagatcactacagccgaaggtgctgggctattggttttggt
ctgaacttcagagttattgctctttctcctggctttagaaagctctctttggaacacttt
gcttcttcttacaacaaggctaccagaagggcaatatttcttgactatgatggcactctt
gtaccccagtcatcaatcaataaagctccaagcgatgaacttattactattctcaacagc
ttgtgtgatgacccgaagaatgatgtattcatagtcagtggaagagcgcgtagtttgctt
gatgagtggtttgctccatgtcagaagcttggtattgcagcagaacatggctattttgtc
agatggaacaaagcagctgaatgggaatcaagctatccaaaccatgattttgagtggaag
cacatcgctgaaccggtcatgcaagtttacaccgaaacaactgatgggtcctccatagag
ccaaaggaaagtgctctagtatggcattatttggatgcagaccatgacttcggttcctgc
caagcaaaggaactactgggtcatcttgaaagggtgctatcaaatgaacctgttgttgtg
aagtgtggtcattacattgttgaagtcaaaccacagggagttagcaagggtcttgttgtg
gacaaggtaattcacagattgatgaacaacgggaagacgcctgatttcgtagtgtgcatc
ggtaacgatcgatctgatgaggacatgttcaaaagcatcgacagcatgacctccagctcc
gcattccctgcagttccagaagtctttgcctgttcagttggtcagaaacccagcaaggca
aagtactatgtcgacgatgctggtgaagtagtaagattgctcaagaatgtagctggcatt
tcgtcgcaccgggaggccgtcagccatggacgtgtgaccttcagggatgtgatggattat
gtggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345706
Entry
4345706           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4345706
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4345706
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4345706
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4345706
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4345706
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4345706
NCBI-ProteinID: XP_015648062
UniProt: Q6ZCH3 A3BTL8
LinkDB
Position
8:21722260..21726129
AA seq 824 aa
MPSLPNSGDEGGAPPPTPPPPGARRVVVAHRLPLRADPNPGAPHGFDFSLDPHALPLQLS
HGVPRPVVFVGVLPSAVAEAVQASDELAADLLARFSCYLVFLPAKLHADFYDGFCKHYMW
PHLHYLLPLAPSYGRGGGLPFNGDLYRAFLTVNTHFAERVFELLNPDEDLVFVHDYHLWA
FPTFLRHKSPRARIGFFLHSPFPSSELFRAIPVREDLLRALLNADLVGFHTFDYARHFLS
ACSRVLGLSNRSRRGYIGIEYFGRTVVVKILSVGIDMGQLRAVLPLPETVAKANEIADKY
RGRQLMLGVDDMDLFKGIGLKLLAMERLLESRADLRGQVVLVQINNPARSLGRDVDEVRA
EVLAIRDRINARFGWAGYEPVVVIDGAMPMHDKVAFYTSADICIVNAVRDGLNRIPYFYT
VCRQEGPVPTAPAGKPRQSAIIVSEFVGCSPSLSGAIRVNPWNVDDVADAMNTALRMSDG
EKQLRQEKHYRYVSTHDVVYWAQSFDQDLQKACKDNSSMVILNFGLGMGFRVVALGPSFK
KLSPELIDQAYRQTGNRLILLDYDGTVMPQGLINKAPSEEVIRTLNELCSDPMNTVFVVS
GRGKDELAEWFAPCDEKLGISAEHGYFTRWSRDSPWESCKLVTHFNWKNIAGPVMKHYSD
ATDGSYIEVKETSLVWHYEEADPDFGSCQAKELQDHLQNVLANEPVFVKSGHQIVEVNPQ
GVGKGVAVRNLISTMGNRGSLPDFILCVGDDRSDEDMFEAMISPSPAFPETAQIFPCTVG
NKPSLAKYYLDDPADVVKMLQGLTDSPTQQQPRPPVSFENSLDD
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgccctccctccccaactccggcgacgagggcggcgccccgcctccgactccgccgccg
ccgggggcgcgccgcgtggtggtcgcccaccgcctccccctccgcgcggatcccaatccg
ggcgcgccgcacgggttcgacttctccctcgacccgcacgcgctcccgctccagctctcc
catggcgtcccccgccccgtcgtcttcgtcggcgtgctcccctccgccgtcgccgaggcc
gtccaggcgtccgacgagctcgcggccgatctcctcgcgcggttctcatgctacctggtg
ttcctccccgccaagctccacgccgacttctacgacggcttctgcaagcactacatgtgg
ccgcatctccactatctcctcccgctcgcgccctcctacggcaggggcggcggcctcccc
ttcaacggcgacctctaccgcgccttcctcaccgtcaacacccacttcgccgagcgcgtg
ttcgagctcctcaaccccgacgaggacctggtgttcgtccacgactaccacctctgggcg
ttccccaccttcctccgccacaaatccccgcgcgcccgcataggtttcttcctccactct
cccttcccctcctccgagctcttccgcgccatccccgtccgcgaggacctcctccgcgcc
ctcctcaacgccgatctcgtgggcttccacaccttcgattacgcgcgccacttcctctcc
gcgtgctccagggtcctcggcctctccaaccgctcgcgccgcggctacatcgggatcgag
tacttcggccgcacggtggtcgtcaagatcctctccgtcggcatcgacatgggccagctc
cgcgcggttctgccgttgccggagacggtcgccaaggccaacgagattgctgacaagtac
aggggacgacagctgatgctcggcgtggacgacatggatttgttcaaggggattgggctc
aagctcttggccatggagaggctgctggagtcgcgggcggacttgcgtggccaggtggtc
ctcgtgcagatcaacaacccggcgcggagccttggccgcgacgtcgacgaggtccgcgcg
gaggtgctggcgatccgtgaccggatcaatgcccggttcggctgggcggggtacgagccg
gtggttgtgatcgacggcgccatgccgatgcacgacaaggtggcgttctacacgtccgcg
gacatctgcatcgtgaatgccgtgcgcgacgggctgaacaggataccgtacttctacacc
gtgtgccggcaggagggcccggttcccaccgctcctgccgggaagccgaggcagagcgcc
atcatcgtgtcagagtttgtcgggtgctcgccgtcgctgagcggcgcgatccgcgtcaac
ccctggaacgtggacgacgtcgcggacgccatgaacacggcgctgaggatgagcgacggc
gagaagcagctgcgccaggagaagcactacaggtacgtgagcacgcacgacgtcgtctac
tgggcgcagtcgttcgaccaggacctgcagaaggcctgcaaggacaactcgtccatggtg
atcctcaacttcggcctcggcatgggcttccgcgtcgtcgcgctcggccccagcttcaag
aaactctcacccgagctcattgaccaagcataccgccagactggcaacaggctcatctta
ctggactacgatggcacagtgatgccacaggggctgatcaacaaggcgcccagtgaggaa
gtgatccgtactctgaatgaactgtgctctgatccgatgaacaccgttttcgtcgtcagc
gggcggggcaaggatgaactggctgaatggtttgcaccatgcgacgagaagctggggatc
tctgcagagcacggctacttcacaaggtggagcagggattctccctgggagtcatgcaag
ttggtgacacattttaattggaagaacatcgcagggcctgtaatgaagcactacagtgat
gcaaccgatgggtcatacatcgaggttaaagaaacatcactagtgtggcactatgaggaa
gccgatccggattttggatcatgccaggccaaagagctccaggaccacctgcagaatgtg
cttgcgaacgagccagtctttgtgaagagcggccatcagattgtggaagttaatcctcag
ggtgtgggcaaaggagtcgccgtgcgtaatctcatttcaaccatgggaaatcgtggcagc
ttgccagatttcatcctctgcgtcggcgatgaccggtcggatgaagacatgttcgaggct
atgatcagcccttcgcctgcgttcccggagactgcacagatcttcccctgcactgttggc
aacaagccgagcttggccaagtactacctggatgacccggctgatgttgtgaagatgctc
cagggcctgacggactcgccgacccagcagcaaccgcggccccccgtctcgttcgaaaac
tcgctagatgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346917
Entry
4346917           CDS       T01015                                 
Name
(RefSeq) probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4346917
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4346917
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4346917
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4346917
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4346917
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4346917
NCBI-ProteinID: XP_015611897
LinkDB
Position
9:complement(12644224..12650075)
AA seq 863 aa
MVSKSYTNLLDMSGEDVFDFQQPFRSLPRFVTSPSITSNPDWDTSNADDSVGPASCCVRK
IIVSNFLPLNCTKDEATGQWSFSMDDNQLLVQLKDGFPMESEVVYVGSLNAEVDPGEQDQ
LSQKLFREYKCIPTFLPADLQQQFYHGFCKQQLWPLFHYMLPICLDKGELFDRSLFQAYV
RANKIFGDKVMEAINSDDDCVWVHDYHLMLLPTFLRKKLHRIKIGFFLHSPFPSSEIYRT
LPVRDEILKSLLNADLIGFQTFDYARHFLSCCSRLLGLNYESKRGHIGIEYFGRTVSLKI
LAVGVHVGRLESVLRLPATISKVQEIEQRYKGKMVMLGVDDMDIFKGISLKLLGLEFLLE
RTPKLRGKVVLVQIINPARSTGKDVEEAINEAVSVAERINIKYGSAEYKPVILIDYPIPS
YEKIAYYAASDCCIVNAVRDGMNLIPYEYTVCRQGNEEIDKLRGVDKSSHHTSTLIVSEF
VGCSPSLSGAFRVNPWSIEDVADALYKAMDLTQSERKLRHDKHYRYVKTHDVAYWARSFS
QDLDRACKDHYSRRCWTTGFGLNFRVIALSPGFRRLSLEHFASSYKKTNRRLIFMDYDGT
LVPQSSVNKVPSAEVISILTSLCNDPKNCVFIVSGRDRTTLSEWFASCDKLGIAAEHGYF
IRWNKEGEWETSSSAQDCEWKNIAEPIMEVYKETTDGSAIETKESGLVWHYQDADHDFGS
CQAKELVSHLERVLANEPVVVKRGHQIVEVKPQGVSKGIAVDTVIRTVINNENAPDFLMC
IGNDRSDEDMFESINEAVSRSVFPTAPDVFACSVGQKASKAKYYVDGCSEVIRLLKGVTA
ITPRREVISQSQVTFRDILEVVS
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggtttcaaagtcatatacaaatcttctagatatgagtggtgaagatgtgtttgacttt
cagcaaccatttagatcgcttcctcgttttgtgacttccccaagcatcacatctaatcct
gattgggatacaagtaatgctgatgattcagttggtcctgcatcttgctgtgtaaggaaa
ataatcgtctccaactttcttccactaaactgtaccaaagatgaagctactggacagtgg
tccttctcaatggatgacaatcaacttcttgttcaacttaaagatggatttccaatggag
agcgaagttgtttatgtgggtagcttgaacgctgaagttgatcctggtgagcaagatcaa
ctttcacagaaacttttcagagaatacaaatgcatacctactttcctcccagctgacctc
cagcagcagttctatcatggattctgtaaacaacaattatggccacttttccattatatg
cttcctatttgcctcgacaaaggcgagctctttgaccgctctctatttcaagcctatgtt
cgggcaaacaaaatatttggtgacaaagttatggaggccatcaattcagatgatgactgt
gtgtgggttcatgattatcacctcatgcttctcccaacctttttaagaaaaaagcttcat
cgcatcaaaattggtttcttccttcacagtccatttccctcctctgaaatctataggaca
ctgccagtaagagatgaaattttgaagtctcttctgaatgctgatctcattggctttcaa
acatttgactatgcccgccacttcctttcatgttgcagcagattgttaggccttaattac
gagtcaaaacgtggtcacatcggtatagagtactttggccgtacggtgagcctcaagatc
cttgctgtgggtgtacatgttggtcgtcttgagtctgtgttgaggctgcctgccacaatt
agcaaggttcaagaaattgagcaaagatataagggtaagatggtgatgttgggtgtagat
gatatggatatcttcaaagggatcagtctaaaattgcttggcttggaatttcttttggag
agaactccaaagctaagagggaaggttgtccttgtgcagattataaatcctgcaagaagc
actggaaaagatgtggaggaagcaataaatgaagccgtctctgtagctgaaaggataaac
attaagtatggttctgctgagtacaagcctgtcatccttatcgactaccccataccttct
tatgagaagattgcatactatgctgcatctgattgctgtattgtaaatgctgtgagggat
gggatgaacttgataccatatgagtatactgtctgcaggcagggaaatgaggagattgat
aagctcagaggtgttgataagagctcacatcacacaagcacactaattgtgtctgagttt
gttggttgctccccatcacttagtggtgctttcagggtaaatccttggagtattgaagat
gtagctgatgcattatataaagcaatggatttgactcaatcggagaggaaattgcgtcat
gataagcattatcgctacgtcaaaactcatgacgttgcttactgggcgcgcagtttttcc
caagatctagatagagcgtgcaaggatcactatagccgaaggtgttggaccactgggttt
ggtttgaattttagagtcattgctctttctcctggatttagaaggctatctttggaacac
tttgcttcttcttataagaagactaatagaaggctgatatttatggattatgatggcacc
cttgtcccccagtcatcagtcaacaaagttccaagtgcagaagtcatttctatccttaca
agcttgtgcaatgatccaaagaactgtgtgttcatagtcagcggaagagatcgtactacc
ctaagtgagtggtttgcttcatgtgataagcttggtattgcagctgaacatggctatttt
atcaggtggaacaaagaaggtgaatgggaaacaagctcctcagctcaagattgtgaatgg
aagaacatcgccgagcctatcatggaagtatacaaggaaacaaccgatgggtctgccata
gagacaaaggagagtgggctagtttggcattatcaggatgcagatcatgacttcggttca
tgccaggcgaaggagctagtgagtcatcttgagagggtgctggcaaatgaacctgttgtg
gttaaacgtggtcatcaaatcgtagaagttaagccccagggtgttagcaaggggattgct
gtggacacagtcattcggacggtaatcaacaacgaaaacgcaccggattttctgatgtgc
attggtaacgatcgatcggacgaggacatgtttgagagcatcaatgaagccgtctcacgt
tctgtgtttcctactgctccagatgtctttgcctgctctgttggccagaaggctagcaaa
gcgaagtactatgtggatgggtgcagtgaggtgatcagattactcaagggtgtaaccgcc
attacaccccgaagggaggtgatcagccagagtcaagtaacattcagggatatacttgag
gttgtcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346981
Entry
4346981           CDS       T01015                                 
Name
(RefSeq) alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4346981
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4346981
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     4346981
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     4346981
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   4346981
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Hydrolase_3
Other DBs
NCBI-GeneID: 4346981
NCBI-ProteinID: XP_015611910
LinkDB
Position
9:13875254..13879646
AA seq 885 aa
MVSRSYSNLLELAAGGGGGGGGEGPLPSLGRRRIPRVVTASGIVPDLDYSDDDAASAASS
SDHSSAHSHAPRERAIIVANQLPIRASRRGGGGGGWEFSWDEDSLLLQLRDSLRAHADRA
DDMEFVYVGGLRDDVPAAEHDEVAHHLLEGFRCVPTFLPADLRSRFYHGFCKQQLWPLFH
YMLPLSPELGGRFDRALWQAYVSVNKIFADKILEVISPDEDYVWVHDYHLMILPTFLRKR
FNRVKLGFFLHSPFPSSEIYKTLPVREELLRSLLNADLIGFHTFDYARHFLSCCGRMLGL
KYESQRGYIALEYYGRTVTIKILPVGVHLEQLRSVLNLPETGVKVAELLKQFCDQNRLML
LGVDDMDIFKGISLKLLAFEQLLMQHPEWRGRVVLVQIANPARGRGKDVKEVQDESYAMV
RRINEAFGQPGYQPVILIDRPLQFYERMAYYVVAECCLVTAVRDGMNLIPYEYVIARQGN
EKLDGILGLGPSARKKSMLVVSEFIGCSPSLSGAIRVNPWNIDAVADAMDSALEMPEGEK
VLRHEKHHKYVSTHDVGYWANSFLQDLERTCLDHSRRRCWGIGFGLRFRVVALDPNFKKL
AVEHLVSAYRRTTTRIILLDYDGTLMPQTSFGKSPSSKTIDMLNSLSRDQNNMVFLVSTK
KRSTLEEWFSSCDNLGLAAEHGYFLRLKRDAEWETCVPVTDRSWKQIAEPVMKTYTETTD
GSTIEDKETAIVWSYEDADPDFGSCQAKELHDHLESVLANEPVTVKAGLNHVEVKPQGVS
KGLVAKRLLSIIRENSLLPDFVLCIGDDRSDEDMFEVITTAAQDNCLSPDAEVFACTVGR
KPSKAKYYLDDLADIVRLIQGLANVSDEMHSTMPTPVDAADTALR
NT seq 2658 nt   +upstreamnt  +downstreamnt
atggtttcgagatcctactccaacttgctggagctcgccgccggcggaggaggaggaggc
ggcggcgaagggccgctgccgtcgctggggcggcgacggattccgcgggtggtgacggcg
tcgggcattgtcccggacctggactactccgacgacgacgcggcgtcggcggcgtcgtcg
tccgaccactcctccgcccactcccacgcgccgcgcgagcgcgccatcatcgtcgccaac
cagctgcccatccgcgcgtctcgccgcggcggcggcggcggcgggtgggagttctcctgg
gacgaggacagcctcctcctgcagctcagggacagcctccgcgcccacgccgaccgcgcc
gacgacatggagttcgtctacgtcggcggcctccgcgacgacgtgcccgcggcggagcac
gacgaggtggcgcaccacctcctcgagggcttccgctgcgtgcccaccttcctccccgcc
gacctccggtcgcggttctaccacggattctgcaagcagcagctgtggccactgttccat
tacatgctcccgctgtcgccggagctcggcggccgcttcgaccgcgcgctgtggcaggcg
tacgtgtccgtcaacaagatcttcgccgacaagatactggaggtgatcagccccgacgag
gactacgtctgggtgcacgactaccatctcatgatcttgccgacgttcctgcggaagcgg
ttcaaccgcgtcaagctcggcttcttcctccacagcccgttcccgtcgtcggagatctac
aagaccctgcccgtccgcgaggagctgctccggtcgctcctgaacgccgatttgatcggg
ttccacaccttcgattatgccaggcatttcctgtcctgctgtggaaggatgctcgggttg
aagtatgagtcgcagaggggctacattgcgctggagtattatggtcggacggttaccatc
aagatattgccggtgggagttcatttggagcagctgcggtcggtgctcaatcttccggag
acgggggtcaaggtggccgagcttctcaagcaattctgcgatcagaaccggctgatgttg
cttggcgtagatgatatggacatctttaaaggaattagcttgaagcttttggcatttgag
cagctcctgatgcaacatcccgaatggcgaggaagggtggttctagtacagattgccaat
ccagcgaggggacgggggaaagatgtgaaagaggtgcaggatgagagctatgcaatggtg
aggcgtatcaatgaggcatttgggcagccaggttaccagccggttatattgatcgatcgg
ccacttcagttctatgagagaatggcttactatgttgtcgctgagtgctgcctggtgacc
gcagtgagagatggcatgaatcttatcccgtatgagtatgtaattgctaggcagggcaat
gaaaaactagacgggatcttaggtcttggcccatcggcacggaagaagagcatgcttgtt
gtgtcagagttcatcggctgttcaccttccctaagtggtgcgattcgggtaaacccttgg
aacatcgatgctgtggctgatgcaatggactctgctttagagatgcctgaaggggagaag
gtgctgagacatgagaagcaccacaaatatgtgagcacacatgatgttggatactgggca
aacagcttcttgcaagatctggagaggacttgtctggaccatagcaggaggcgttgttgg
gggataggattcgggctaaggtttagggttgtagcccttgatccaaacttcaagaagctt
gcagttgagcaccttgtctcagcctaccggaggacgaccacgcgaatcattcttttggac
tatgacgggacgctgatgcctcaaacatcatttggtaagagcccaagctctaaaacgata
gatatgctgaacagcctgtcccgtgatcagaacaacatggtcttccttgtgagcacaaag
aagcggtcgactctagaagaatggttctcatcatgcgacaacctaggcttagctgctgag
catggatactttctcaggctgaagagagatgcagaatgggagacgtgtgtcccagtgaca
gacagaagctggaagcaaatcgcagagcctgtgatgaaaacatacaccgagacaacagat
gggtcaacaattgaggacaaggagaccgcgatagtgtggagctacgaggatgctgatcct
gattttggatcttgccaagccaaggagctccatgaccatctggagagtgtccttgcaaat
gagccagttacagtaaaagctggcctgaaccatgtcgaggtgaagccacagggtgtaagc
aagggccttgtggcaaaacggcttttgtcgataatacgggagaacagcctccttccggac
tttgtcctctgcatcggtgatgaccgctccgatgaagacatgttcgaggtgatcaccact
gcagcacaggacaactgcctaagcccagacgccgaggtcttcgcctgcaccgttggtcgc
aagcccagcaaggccaagtactacctggatgacctggccgacattgtgaggctgatccag
ggcctcgccaatgtctctgacgagatgcacagcacaatgcccacacctgtcgacgccgca
gacaccgccctgaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266089
Entry
9266089           CDS       T01015                                 
Name
(RefSeq) alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    9266089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    9266089
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     9266089
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     9266089
Glycosyltransferases [BR:osa01003]
 Others
  Trehalose
   9266089
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Glyco_trans_1_2 Glyco_trans_1_4
Other DBs
NCBI-GeneID: 9266089
NCBI-ProteinID: XP_015640390
LinkDB
Position
5:25713775..25722088
AA seq 980 aa
MPTPAPSASSSSSSCGGGGGGAGAASSYSSSPDDRMLRGECGRRHPFASSAAVGAGSPDA
MDTDSAEPSSAATSVADFGARSPFSPGAASPANMDDAGGASAAGHAARPPLAGPRSGFRR
LGLRGMKQRLLVVANRLPVSANRRGEDQWSLEISAGGLVSALLGVKDVDAKWIGWAGVNV
PDEVGQRALTRALAEKRCIPVFLDEEIVHQYYNGYCNNILWPLFHYLGLPQEDRLATTRN
FESQFNAYKRANQMFADVVYQHYKEGDVIWCHDYHLMFLPKCLKDHDINMKVGWFLHTPF
PSSEIYRTLPSRSELLRSVLCADLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQGRLT
RVAAFPIGIDSERFKRALELPAVKRHITELTQRFDGRKVMLGVDRLDMIKGIPQKILAFE
KFLEENHEWNDKVVLLQIAVPTRTDVPEYQKLTSQVHEIVGRINGRFGTLTAVPIHHLDR
SLDFHALCALYAVTDVALVTSLRDGMNLVSYEYVACQGSKKGVLILSEFAGAAQSLGAGA
ILVNPWNITEVADSIKHALTMSSDEREKRHRHNYAHVTTHTAQDWAETFVCELNETVAEA
QLRTRQVPPDLPSQAAIQQYLHSKNRLLILGFNSTLTEPVESSGRRGGDQIKEMELKLHP
ELKGPLRALCEDEHTTVIVLSGSDRSVLDENFGEFNMWLAAEHGMFLRPTNGEWMTTMPE
HLNMDWVDSVKNVFEYFTERTPRSHFEHRETSFVWNYKYADVEFGRLQARDMLQHLWTGP
ISNAAVDVVQGSRSVEVRSVGVTKGAAIDRILGEIVHSKSMITPIDYVLCIGHFLGKDED
IYVFFDPEYPSESKVKPDSSGSVSLDRRPNGRPSNGRSNSRNSQSRTPKAQAAPERSSSS
SSSSQGTPNSHHDWREGSSVLDLKGENYFSCAVGRKRSNARYLLNSSEEVVSFLKEMADA
TAAHNGFQSTTADYMFLDRQ
NT seq 2943 nt   +upstreamnt  +downstreamnt
atgccgacccccgcgccgtcggcatcgtcctcctcctcctcctgcggcggcggtggcggt
ggcgccggggccgcgtcgtcctactcctcctccccggacgaccgcatgctccgcggggag
tgcggccgccgccaccccttcgcgtcgtcggcggcggtgggggccggttccccggacgcc
atggacacggactccgcggagccttcctccgcggcgacctccgtcgcggacttcggggcc
cggtcgccgttctcgccgggggccgcctcgcccgccaacatggacgacgcgggcggcgcg
tcggcggcggggcacgcggcgcggccgccgctcgccgggccgcgcagcgggttccgccgc
ctcggcctccgcgggatgaagcagcgcctcctcgtcgtcgccaaccgcctccccgtctcc
gccaatcgccgcggcgaggaccagtggtccctggagatcagcgccggcggcctcgtcagc
gccctcctcggcgtcaaggacgtggacgcgaagtggatcggatgggcgggcgtcaacgtc
cccgacgaggtcggccagcgagctctcacccgagcgctcgccgagaagagatgtatacca
gtgttcctggatgaggaaatcgtgcaccaatactacaacggatactgcaacaacatactc
tggcctctgtttcactacctgggattgccacaggaggacaggttggcgacgacgaggaat
ttcgagtcacagttcaacgcgtacaagcgagcaaaccagatgttcgctgatgttgtgtac
cagcactacaaggaaggggatgtgatctggtgccatgattaccacctcatgttcctgccc
aagtgcctcaaggatcatgacatcaacatgaaggtcgggtggttcctgcacacgccattc
ccttcttcggagatttaccggacgctgccctcccggtcggagctgcttcgctccgtgctc
tgtgctgatttagtcggatttcatacatatgattatgcaagacattttgtgagcgcatgt
acaagaatacttggactggagggcactcctgagggtgtggaagaccaaggaaggctaacc
agagttgctgcgtttcctattgggatagactctgaacgtttcaagcgagcattggagctt
ccagcagtaaaaagacacatcactgaattaacacaacgttttgatggtcgaaaggtaatg
cttggtgttgaccgacttgacatgatcaaaggaattccgcaaaagattttggcctttgaa
aagtttctcgaagaaaaccatgaatggaatgataaagtggttctacttcaaattgctgtg
ccgacaagaactgatgtccctgagtatcaaaagcttacaagtcaggtgcatgaaattgtt
gggcgcataaatggccgatttggaacactgactgctgttcctattcatcatctggaccga
tctcttgatttccatgccttgtgtgccctttatgcagtcactgatgtggcccttgtaaca
tcgctgagagatggaatgaatcttgtaagctatgaatatgttgcatgccaaggatcaaaa
aaaggagttttgatattgagtgagtttgctggggcagcacagtctcttggagccggtgct
attttagtaaacccctggaatattactgaagtcgcagactcaatcaagcatgctttgaca
atgtcatctgatgagagagaaaagcgacataggcataactatgctcatgtgacaactcac
actgcacaagattgggccgaaacttttgtatgtgagttaaatgagacagttgctgaagct
cagctgagaacaagacaagttccacctgatctccctagtcaagcagcaattcaacaatat
ctgcattccaaaaatcggttgctcatattggggttcaattcaacattgactgagccagtt
gaatcctctgggagaaggggtggtgaccaaatcaaggaaatggagctcaagttgcatcct
gagttgaagggccctttgagagccctctgtgaggatgagcatactacagttattgttctt
agtggaagtgacaggagcgtccttgatgaaaatttcggagaattcaatatgtggttagca
gcagagcatggcatgtttttacgtccaactaatggagagtggatgacaacaatgcctgag
catctgaacatggattgggtagacagtgtaaagaatgtttttgaatactttacagaaaga
accccaaggtctcattttgaacaccgtgagacatcatttgtatggaattacaagtatgct
gatgttgagtttggacggctccaagcaagagatatgctgcagcacttgtggacaggtcca
atctcaaatgcagcagtcgatgttgttcaaggaagccgatcagttgaagttcggtctgtc
ggagttacaaagggtgctgcaattgatcgtattctaggagagatagttcatagcaaaagc
atgattactccaattgattatgttctatgcattgggcacttcctaggaaaggatgaggac
atctatgtctttttcgatcccgagtacccttctgaatcaaaagtaaaaccagatagcagc
ggctcggtatctcttgacaggaggccaaatggacgaccatcaaacggcaggagcaattcc
agaaactcgcagtcaaggacacccaaggcacaggctgctccggagaggtcatcgtcatca
tcttcatcaagccagggcaccccaaacagccaccatgactggcgcgaagggtcctcggtc
cttgacctcaagggcgagaattatttctcctgcgctgttggaaggaagcggtccaacgcc
cgctacctgcttaactcgtcagaggaggtcgtctccttcctcaaggagatggcagatgca
acggcggctcacaatgggttccagtccacaactgcggattacatgttcttggataggcag
tag

DBGET integrated database retrieval system