KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324446
Entry
4324446           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S1 homolog A
  KO
K02945  small subunit ribosomal protein S1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4324446
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4324446
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    4324446
SSDB
Motif
Pfam: S1
Other DBs
NCBI-GeneID: 4324446
NCBI-ProteinID: XP_015613044
UniProt: Q5ZC75 A0A0P0V4M6
LinkDB
Position
1:complement(22979948..22983194)
AA seq 438 aa
MPPSMAVAAAAAAPRSLLFPVSPSPSQPRRVPALARAGRSQRRHAALARPARRHLDDAMS
AGFVRSLNAPPDEDGARSGGRYDPRPGDFAVGVVVSGTEARLDVAVGADRLATLLAKELL
PLYRADLPAFAEAAPPRPGSVGAVASPAAGEGDRKPGERGGGRTLVPPGTVVFAEVLGRT
LSGRPLLSARRLFRRLAWHRARQVMQLDEPIEVKIYEWNTGGLLTRIEGLRAFLPKFELM
DRINTFTDLKNKVGCSIRVCITRLDEETNDLIISEKKAWEMTYLKEGTLLQGIVHKIFPY
GAQVRIAGTNRSGLLHISNISRGRVLSVSDILKIDEEVKVLVVKSNVPDKIALSISDLES
TPGLFLSEKARVFSEAEEMAERYREQLPADSKNAKLDADLPGGTIPFDDEATLYANWKWF
KFLEDGKLGAVTTEHNGS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgccgccgtcgatggcggtggcggcggcggcggcggcgccacgcagtctcctcttcccc
gtctcgccttcaccctcgcagccgcggcgtgtgccagccttggcaagggctggacggagc
cagaggcggcatgcggcgctggcgaggcccgctcgccgccacctcgacgacgcgatgtcc
gccgggttcgtccgcagcctcaacgccccgcctgacgaggacggcgcgagatccggcggg
aggtacgaccccaggccgggggacttcgccgtcggggtggtggtctccggcaccgaggcc
cgcctcgacgtcgccgtgggcgccgaccgcctcgccacgctcctcgccaaggagctcctc
ccgctctaccgcgccgacctcccggccttcgctgaggcggctccgcctcggccggggagc
gtgggtgccgtggcgagccccgccgcgggcgagggggaccggaagccgggggagcgcggc
gggggcaggacgctggtgccgcccggcacggtggtgttcgcggaggtgctcggccgcacg
ctgagcggccggccgctgctgtcggcgaggcgactcttccgccgcctcgcatggcaccgc
gccaggcaggttatgcagcttgacgagccaattgaggtcaaaatttacgagtggaacacc
gggggcctcctcacaagaattgaggggctgagagcattccttcctaagtttgagctcatg
gacaggataaatacgttcacagacttgaaaaacaaagttggttgcagcatacgtgtgtgc
attacaaggcttgatgaagaaactaatgacctgataattagtgaaaagaaagcatgggaa
atgacatatcttaaagaaggaactcttcttcaagggatcgttcacaagatttttccgtat
ggtgctcaggttagaatagctgggacaaacagaagtggattgttgcatatttcaaatatt
agtcgagggcgtgtcttgtcagtaagtgacatcctaaagatagatgaggaggtaaaagtt
ctggtggtcaagtcaaatgttccagataaaatcgcgcttagcatatctgacctcgaaagt
acacctggtctattcctttcagaaaaagcgagagtgttctcagaagctgaggaaatggca
gagaggtaccgggagcagcttccagctgactctaagaacgctaaattagatgctgacctt
ccaggaggaacaattccatttgatgatgaagctacattatacgcaaactggaaatggttt
aaatttttggaagatggcaaactaggtgctgtaacaacagaacacaatggcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332652
Entry
4332652           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S1, chloroplastic
  KO
K02945  small subunit ribosomal protein S1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332652
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332652
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    4332652
SSDB
Motif
Pfam: S1
Other DBs
NCBI-GeneID: 4332652
NCBI-ProteinID: XP_015628466
UniProt: Q10MB2
LinkDB
Position
3:complement(11351445..11355768)
AA seq 402 aa
MASLAQHVAGLASPPLSGAPRRRPAAPTRPSALVCGTYALTKEERERERMCQLFDEASER
CRTAPMEGVSFSPEDLDSAVESTDIDTDIGSLIKGTVFMTTSNGAYVDIQSKSTAFLPLD
EACLLDVNHIEEAGIRAGLVEEFMIIDENPGDETLILSLQAIQQDLAWERCRQLQAEDVV
VTGKVIGGNKGGVVALVEGLKGFVPFSQVSSKSTAEELLDKELPLKFVEVDEEQGRLVLS
NRKAMADSQAQLGIGSVVLGTVESLKPYGAFIDIGGINGLLHVSQISHDRVADISTVLQP
GDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKADEMAQIFRQRIAQAEAM
ARADMLRFQPESGLTLSSEGILGPLSSDTPSEGSGEGQTTDE
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcgtccctggcgcagcacgtcgcggggctggcgagcccgccgctctccggcgcgccg
cggcgccgccccgcggcgcccacgcggccgtcggcgctggtgtgcgggacgtacgcgctc
accaaggaggagcgggagcgggagcggatgtgccagctgttcgacgaggcctccgagcgc
tgccgcaccgcgcccatggagggcgtctccttctcgcccgaggacctcgactccgccgtc
gagtccaccgacatcgacaccgatatcggctcactcattaaaggaacagtgttcatgacc
acttcaaatggtgcatatgttgatatccaatcgaagtctactgctttcttgcctttggat
gaggcatgccttctcgatgtcaaccatatagaagaggcagggatccgtgcaggtttggta
gaagagttcatgattattgacgagaatcctggtgatgaaactttgattttgagcttacaa
gcaattcagcaagaccttgcctgggaaaggtgcagacagcttcaagcagaagatgttgtt
gtcacgggtaaagtaattggtggaaacaaaggaggtgtggtagctcttgtggagggcctt
aagggatttgttccattttcacaagtgtcatcgaaatcaactgctgaagaactgcttgac
aaagaactacctctgaagtttgtggaggtcgatgaggaacaaggcaggcttgtcctcagt
aaccgcaaggcaatggcagatagtcaagctcagcttggtattggttcagttgtcttggga
actgtcgagagcctgaaaccttatggtgcatttatcgacattggtggaatcaatggcctt
ctccatgtcagccagattagtcatgaccgtgttgcggacatctcgacagttctgcaacca
ggagatacgctcaaggttatgattctaagccatgaccgtgaaagaggccgtgttagtctt
tctactaaaaagcttgagccgacacctggtgacatgattcgcaatccaaagcttgttttt
gagaaggctgatgagatggctcagatattcaggcagaggatagctcaagcagaggcaatg
gctcgtgctgatatgttaagattccagcctgagagtggattaactctcagttcagagggc
atcttagggccattatcatcagacacaccttctgagggctcgggagaagggcaaaccaca
gatgaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339443
Entry
4339443           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4339443
  KO
K02945  small subunit ribosomal protein S1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339443
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    4339443
SSDB
Motif
Pfam: S1
Other DBs
NCBI-GeneID: 4339443
NCBI-ProteinID: XP_015638077
UniProt: A0A0P0WPT1
LinkDB
Position
5:26608245..26612469
AA seq 519 aa
MPPPSLLSLLPAASVSPRSRRAARRRPPTASRLPVRGARAASPLHASSSSSSGGGEGGGG
DELHLLEKPFPSPSPADEDESESTEAAPALSTEEALAPFLKFFQGKSTEPDEDDAAAGGG
GGGGGGYVEEDEEDKGEGSAGAGAGGRGVVYYDPKPGDLAVGVVVGGDGRTLDIDVGAGG
EPALMLAKEAVPMTGEEFEYLACDVASKDAAQFAAEGKVGVVVSGGEGQGEATGGRNGKG
RGRGSPALGVGTVVFTEVLGRTLGGRPLLSARRLFRRVAWHRVRQIKQLNVPIKVKIFEW
NAGGLLTRIEGLRAFLPKPEMMTRPRNFTDLKNTVGQQIHVCITRIDEKANELIISEKEA
WAMTYLREGTLLQGTVRKLFPYGAQITIGDTNRGGLLHVSNITRGQLTSVGDVLKVGEEV
KAIVIKSTAPGRIALSTKDLESEPGLFLSNKEKVFSEAEEMAQRYRDQISEKHQPAELDS
SFDEVAPFDDEAVSYANWKWLRFSKSDKTNFNPRAESGL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgccgcccccgtccctcctctccctcctccccgccgcctccgtctccccgcgaagccgc
cgagcggcgcggcggagaccccccaccgcgagccgcctccccgtccgcggagcacgagct
gcgtcgccgctccacgcctcctcctcctcctcctccggtggcggcgaaggcggaggaggt
gatgaactgcacctcctcgagaagccgttcccttccccatcccccgccgatgaggatgag
tctgagtcgaccgaggccgctccggcactgtccacggaggaggcgctcgcgccgttcctc
aagttcttccaggggaagagcaccgagcccgacgaggacgacgcggcggcgggaggcggc
ggcggcggcggcggaggctatgtggaggaagacgaggaggacaagggggaggggagtgcc
ggagctggtgcgggtgggcgtggggtcgtgtattacgaccccaagcccggggacctcgcg
gtcggcgtcgtggtcggcggcgacgggaggacgctcgacatcgacgtcggcgccggtggc
gagccggcgctgatgctggccaaggaggcggtgcctatgaccggggaggagtttgagtac
ctggcatgcgacgtggcgtcgaaggatgcagcccagttcgccgcggaagggaaggtggga
gtcgtggtcagcggcggggaggggcaaggagaggcgacgggcgggaggaacggaaagggg
agagggagaggttcgccggctttgggcgtcggcacggtggtgttcaccgaggtcctcggt
cgaacacttggcgggcggccgctgctgtccgcgcgccggctgttccggcgcgtcgcgtgg
cacagagtgaggcagataaagcagttaaatgtgcctatcaaggttaaaatttttgagtgg
aatgccggaggcctgctgacaagaattgaggggcttcgggcattcctccctaaacctgaa
atgatgactagaccaagaaacttcacggatctaaagaatactgttggtcaacagatccat
gtctgcatcacaaggattgatgaaaaagctaacgaattgataattagtgaaaaagaagca
tgggcaatgacataccttagggaaggaactcttttgcaagggacagtccgcaaattgttt
ccatacggtgcacaaattacgattggcgacactaacagaggtggattgctacatgtctca
aatataacacgggggcagctaacatccgttggtgatgtgctaaaagtgggtgaggaagtg
aaagctatcgtgattaaatcaacagccccgggcagaattgctctcagtaccaaggacctt
gagagcgaacctggactgtttctctctaacaaggagaaggtgttctccgaggctgaagag
atggcgcaaagataccgggaccaaatttcagagaagcatcaaccagctgagttagactcc
tcgttcgacgaggttgctccctttgacgacgaggcagtgtcttatgcgaactggaagtgg
ttaagattcagcaaatctgacaaaacaaactttaaccctcgtgctgaatcgggtttgtaa

DBGET integrated database retrieval system