KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324461
Entry
4324461           CDS       T01015                                 
Name
(RefSeq) VAMP-like protein YKT61
  KO
K08516  synaptobrevin homolog YKT6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4324461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324461
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    4324461
SSDB
Motif
Pfam: Synaptobrevin Longin DDE_Tnp_IS66_C
Other DBs
NCBI-GeneID: 4324461
NCBI-ProteinID: XP_015622494
UniProt: A0A8J8YI16 Q5JMS3
LinkDB
Position
1:complement(42479709..42483449)
AA seq 214 aa
MKITALLVLKSPGDGDSSSGGGGGEQEQEQQAAVVVANATDVSHFGYFQRNPAREFILFV
ARTVAARTPAGRRQSVQHEEYKVHCYNQNGLCAIAFTDDHYPVRSAFSLLNTVLEEYHKT
FGERWRTAKTDNTQPWQYLDDALTKYQDPAEADKLLKIQRDLDETKIILHKTIDSVLSRG
ERLDSLVEKSSDLSAASQMFYKQAKKTNSCCTIL
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaagatcacggcgctgctggtgctcaaatcccccggcgacggcgactcgtcgtcgggt
ggcggtggcggcgagcaggagcaggagcagcaggcggcggtggtggtggcgaacgcgacc
gacgtgagccacttcggctacttccagcgcaaccccgcccgcgagttcatcctcttcgtc
gcccgcaccgtcgccgcccgcacccccgccggccgccgccagtctgtccagcacgaagag
tacaaggtgcattgctacaaccagaatggcctctgcgccatcgccttcaccgacgaccac
taccccgtcaggagcgccttctccctcctcaacacggtgctggaagagtaccacaagact
tttggggagagatggaggacagcaaaaactgataacacccagccttggcaatacctggat
gatgccttgacaaaataccaggatcctgcagaggctgacaagttgctgaaaattcagagg
gatttggatgaaactaagattattcttcacaagaccatcgatagtgtactttctagaggt
gaaagattggatagcctagtggagaagagttcagatctaagtgctgcttcacagatgttc
tacaagcaggccaagaaaaccaactcttgttgtacaatcctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325070
Entry
4325070           CDS       T01015                                 
Name
(RefSeq) VAMP-like protein YKT61
  KO
K08516  synaptobrevin homolog YKT6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4325070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4325070
Membrane trafficking [BR:osa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    4325070
SSDB
Motif
Pfam: Synaptobrevin Longin DUF4618
Other DBs
NCBI-GeneID: 4325070
NCBI-ProteinID: XP_015641471
UniProt: Q5N9F2 A0A0N7KE44
LinkDB
Position
1:37514768..37518569
AA seq 216 aa
MKITALLVLKPSSSGGGASSSGGGGGSGGPEAVVLANATDVSHFGFFQRGAAREFIVFVA
RTVAQRTQPGQRQSVQHEEYKVHSHNRNGLCAVAFMDDHYPVRSAFSLLNKVLDEYQKAF
GDSWKAATKDATDAAQQWPFLTDALTKFQDPAEADKLMKIQRDLDETKIILHKTIESVLQ
RGERLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaagatcacggcgctcctcgtgctgaagccgtcgtcctccggcgggggagcatcctcg
tccggcggcggcggcgggtcgggcggccccgaggcggtggtgctggcgaacgcgacggac
gtgagccacttcgggttcttccagcggggcgccgcgcgggagttcatcgtcttcgtcgcg
cgcaccgtcgcccagcgcacccagccaggccagcgccagtccgtccagcacgaagaatac
aaggtccactcacacaacaggaatggtctttgcgcagttgcatttatggatgatcactat
cctgtacgaagtgcattttctcttctgaataaggtacttgacgaataccagaaggctttc
ggggactcttggaaagctgctacaaaagatgcaacagatgctgcccaacagtggcctttc
ttgacagatgctttgacaaagtttcaggaccctgcagaggctgacaagttaatgaaaatc
cagagggacttggatgaaacaaaaattatcctacataaaactattgagagtgtgctccaa
agaggggaaagattggatagcttggttgagaagagttcagacctgagtgctgcttcacag
atgttctacaagcaggcaaagaaaacaaaccaatgctgtactatactctga

DBGET integrated database retrieval system