KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324465
Entry
4324465           CDS       T01015                                 
Name
(RefSeq) uridylate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4324465
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     4324465
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-GeneID: 4324465
NCBI-ProteinID: XP_015638950
UniProt: Q5JJV9 A0A8J8XDX3
LinkDB
Position
1:42562810..42566963
AA seq 351 aa
MAAAAAAAVACGMSTSFLIRLSPSPPASSHVPLPRSPASSARPRRASSVSLSTAPRPRAR
AAGSDSPSNFGGQTSLMPPFSLMLDEGSRSKKPYRWQRVLLKVSGEALAGDHTENIDPKI
TMAIAREVASVTRLGVEVAIVVGGGNIFRGASWAGCSGLDRSSADYIGMLATVMNAIFLQ
ATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALR
CAEINAEVVLKATNVDGVYDADPKRNPNARLLEAVSYHEVQTRDLSVMDMTAITLCQENN
IPVVVFNLQKPGNIAKAIVGEKVGTFIGCTKDQDQIVGNALDQERRLVNEL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgccgccgtcgcctgcggcatgtctacgtccttcctcatccgc
ctctcgccttcgccgccggcgtcttcccacgtgcctctccctcggtctccggcttcgtcg
gcgcgcccgcggcgagcgtcttccgtctccctctccaccgcgcctaggccgagggcacgc
gccgccggctccgactctccctccaactttggaggtcaaacatcactgatgccaccattc
agccttatgcttgatgaaggctctagatctaaaaagccatatagatggcaaagggtgttg
cttaaagtaagtggggaggctcttgctggagatcacacagaaaatattgatccaaagatc
acgatggcaattgcaagagaggttgcttctgtcaccagactaggtgtagaggttgctatt
gttgttggtggcggcaatatcttccgcggggcctcttgggctggatgtagtggactcgac
cgctcatcagcagattacattggcatgttggctactgtgatgaatgccatatttcttcaa
gcaacaatggagagcattggaataccaacccgtgtccaaactgcatttcgtatgtcagaa
gttgcagaaccatacatacgccgaagagctgtcaggcatttagagaaaggaagagttgtt
atatttgctgctggtacagggaacccattctttacaactgatacagctgctgctcttcgt
tgtgcagaaatcaatgcagaggtagtacttaaggcaacaaatgttgacggtgtgtacgac
gcagaccccaagcgtaacccaaatgcccgccttcttgaggctgtgagctaccatgaggtg
caaacaagagacctctcagtaatggacatgactgccattacgctatgccaagaaaacaac
attcctgttgtcgtgtttaatttgcaaaaacctggaaatattgcgaaagctattgttggt
gagaaggttggcacgtttataggctgcacaaaagatcaggaccagattgtggggaatgca
ctggatcaagaaagaagattggtgaacgagttatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330910
Entry
4330910           CDS       T01015                                 
Name
(RefSeq) UMP-CMP kinase 4-like
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4330910
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     4330910
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Thymidylate_kin AAA_19 AAA_30 AAA SRP54
Other DBs
NCBI-GeneID: 4330910
NCBI-ProteinID: XP_015625895
LinkDB
Position
2:32951569..32955075
AA seq 222 aa
MGSVVDAPTVVAGQEEVTDNMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFIHLSAGD
LLRAEIKSGSENGTMIENMIKEGKIVPSEVTIKLLQEAMIKSGNDKFLIDGFPRNEENRA
AFENVTKITPAFVLFFDCSEEEMERRLLGRNQGRVDDNIETIRKRFKVFVESSLPVIEYY
NAKDKVKKIDAAKPIPEVFEDVKAIFAPYAPNALLSGVTTNL
NT seq 669 nt   +upstreamnt  +downstreamnt
atgggttcggttgtggatgctccaacagttgtggctggacaggaggaggtcactgacaac
atgttgggtgacaagaaagttacagttgtatttgttctaggtggtcctgggagtggaaag
ggcacacagtgtgccaacattgttgaacactttggattcattcatcttagtgctggagac
cttttgcgtgcagagatcaaatctggctctgagaacggaactatgatcgagaacatgata
aaggagggaaagattgttccatctgaggtaactataaaactcttgcaggaagccatgatt
aaaagtggaaatgataagttccttattgatggatttccaaggaacgaagagaatcgtgct
gcatttgagaacgttacaaaaataactcctgcgtttgtgctattcttcgattgttctgag
gaagagatggaaagacgtcttttgggacgcaatcagggaagagttgacgataacattgag
actatcaggaaaaggttcaaagtttttgttgaatccagtttgcctgtcattgagtactat
aatgcaaaggacaaggttaaaaagattgatgctgcaaaaccaattcctgaggtgtttgaa
gatgtcaaagccattttcgctccatatgcgccaaatgctttgctctcaggtgtgactaca
aatctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334909
Entry
4334909           CDS       T01015                                 
Name
(RefSeq) UMP-CMP kinase 2 isoform X1
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4334909
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     4334909
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin AAA_33 Hydin_ADK
Other DBs
NCBI-GeneID: 4334909
NCBI-ProteinID: XP_015637025
LinkDB
Position
4:complement(362891..368722)
AA seq 298 aa
MWRRQVGALLLRHRSTPSSTLRHHLPLPVPDQSPPLASNLLLRLFTSQSGEGGDGATKPF
IAFVLGGPGSGKGTQCVRIASDFGFAHLSAGDLLRSEISTGSEKGELILNIIKEGKIVPS
EITVELIRKAMESSDAKRVLIDGFPRCEENRIAFERITGTEPDLVIFFDCPEDEMVKRLL
GRNQGRVDDNIETIKKRLKVFESLNIPVVDYYTSRGKVHKINATGTEEEIFGAVHKLFSS
LRALGSVQMVGKVCICSMHGRRLVMMLFLQLQPGDRLSAGYSLSPVFSLFHVGFILDE
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtggcggcggcaagtgggtgcccttcttctccggcaccgatccacgccttcctccacc
ctccgccaccatctccccctccccgtccccgaccagagcccacctctcgcttccaatctt
ctgctccgcctcttcacttctcaatctggagaggggggtgatggtgccaccaagcccttc
attgctttcgtcttagggggtcccgggagtgggaaaggtacgcaatgtgtccggatcgct
tctgattttgggtttgctcatttgagtgctggtgaccttctacggagtgaaatttcaact
ggcagtgagaaaggggagttgatcttaaatataataaaagaagggaagattgttccatca
gagattactgttgaactgattagaaaagctatggaatcgagcgatgctaaaagggttctt
attgatggtttcccaaggtgtgaggaaaacaggatcgcctttgaaagaataactggaaca
gaaccagaccttgtgattttctttgactgccctgaggatgagatggttaaacgtttacta
ggccgtaaccagggacgagtggatgataacattgaaacaatcaagaagcgcctaaaggtg
tttgagagtctaaatattcctgttgttgactactacacttcaagaggaaaggttcacaag
ataaatgcaaccggaactgaagaagaaatctttggagcagtccacaagctgttttcctcc
ttaagggcattgggaagcgtgcaaatggtgggaaaagtttgcatctgcagcatgcatgga
cgacgattggtcatgatgctttttctacagctgcagcccggcgatagattaagcgccggc
tactctctctctcctgttttctcactcttccatgtaggatttatcttagatgaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339882
Entry
4339882           CDS       T01015                                 
Name
(RefSeq) UMP-CMP kinase 1 isoform X2
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4339882
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     4339882
SSDB
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Thymidylate_kin Cytidylate_kin SRP54 dNK CPT Zeta_toxin DUF4952 AAA_19
Other DBs
NCBI-GeneID: 4339882
NCBI-ProteinID: XP_015641837
UniProt: Q5VRN0
LinkDB
Position
6:564352..567685
AA seq 243 aa
MAHANKNHIESFPPPGKKITIVFVIGGPGSGKGTQCAKIVKQFGFTHLSAGDLLREEAKY
DTEQGTMIKNLMNEGKLVSSDLIVKLLFKAMRESGNDKFLVDGFPRNEENRHAYENIIHI
EPEFLLFIDCSKEEMERRILNRNQGRDDDNIDTIRRRFDVFQQQTLPVIQYYEKRGKLRK
VDGNRQVDEVFEDVKAIFAQLNNQKIHGGQQASGLSRAQMNPLKRWFFDFFCGCFGTKEE
ARN
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcacacgcaaacaagaatcacattgagtcatttccacctcctgggaaaaagataaca
atcgtgttcgtcataggtggccctggcagtggcaaaggcactcaatgtgccaaaattgtt
aagcagtttggctttacacatctgagtgctggtgatctccttcgtgaagaagcaaaatat
gatactgaacaaggtacaatgatcaagaatctcatgaatgaagggaagcttgtgtcatct
gatctcatcgttaagctactatttaaggccatgcgagaaagtgggaatgataagttcctt
gttgatggatttccacgaaatgaagaaaatcgacatgcgtatgaaaatattatccacatt
gagccagagttcctgctgttcattgactgctcaaaggaagagatggagcggcgcattttg
aaccgaaaccagggaagagatgatgacaacatcgacactattaggagacgctttgatgtt
tttcagcagcaaactcttccagttattcagtactatgagaaaagggggaaactcagaaag
gttgatggtaaccgacaggtagatgaagttttcgaagacgttaaggccatttttgctcag
ttgaacaatcagaaaattcatggtggccagcaagctagtggtttgagcagagcacaaatg
aatccattgaaacgttggttctttgactttttctgcggttgctttgggactaaagaagaa
gcaagaaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343960
Entry
4343960           CDS       T01015                                 
Name
(RefSeq) UMP-CMP kinase 3 isoform X2
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4343960
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     4343960
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Thymidylate_kin AAA_19 SRP54
Other DBs
NCBI-GeneID: 4343960
NCBI-ProteinID: XP_015644853
UniProt: Q7XI40
LinkDB
Position
7:complement(25878468..25882554)
AA seq 210 aa
MGSVVDAPVVVEGVAENMLGDKKVTVVFVLGGPGSGKGTQCANIVEHFGFTHLSAGDLLR
AEIKSGSENGTMIENMIKEGKIVPSEVTIKLLQDAMIKNENDKFLIDGFPRNEENRAAFE
NVTKISPAFVLFFDCSEEEMERRLLGRNQGRVDDNIETIRKRFKVFVESSLPVIEHYNAK
NKVKKIDAAKPISEVFEDVKAIFAPYAKVE
NT seq 633 nt   +upstreamnt  +downstreamnt
atgggttcagttgtggatgctccagtggttgtggagggggttgctgagaacatgttgggt
gataagaaagttacagttgtatttgttctaggtggtcctggaagtggaaaaggcacacag
tgtgccaacattgtggaacactttggattcacccacttaagtgctggagaccttttgcgt
gcagagataaaatctggttctgagaatggaactatgattgagaacatgataaaggagggg
aagattgttccgtcagaggttactataaagctcttgcaagatgccatgattaaaaatgag
aatgataagtttctaatcgatgggttcccaaggaatgaagagaatcgtgctgccttcgag
aatgttacaaaaatttcccctgcatttgtgctattttttgactgttctgaagaagagatg
gaaagacgtcttttgggacgcaatcagggtagagttgatgacaacattgagaccattagg
aaaagattcaaagtttttgttgaatcaagtttgcctgtaattgagcactacaatgcgaag
aacaaagttaaaaagattgatgctgcaaaaccaatttctgaagtgtttgaagatgtcaaa
gccatttttgccccatatgctaaggttgaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267059
Entry
9267059           CDS       T01015                                 
Name
(RefSeq) UMP-CMP kinase 4-like isoform X1
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    9267059
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     9267059
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Thymidylate_kin AAA_19
Other DBs
NCBI-GeneID: 9267059
NCBI-ProteinID: XP_015643869
LinkDB
Position
6:5221409..5225291
AA seq 237 aa
MRGGLVASARLLPRPLVRWFLQRRAQQDINENMLGGKKVKIIFVLGGPGSGKGTQCSNIV
EHFGFIHLSAGELLRAEINSGSENGTMIDTIITEGKIVPSEITIKLLQEAIIKGGNDKYI
IDGFPRNEENRVVFESVTLVTYFQLLQISISPEFVLFFDCSEEEMERRLLGRNQGRSDDN
IETIRKRLKVFVESSLPVIEYYESKGMVKKVCTFVMVMHASCSTVYSPYRIYRLVII
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcgtggaggtctggtcgcctctgcgcggctactccctcgccctctcgtccggtggttt
ctccagcgacgagctcagcaggatattaatgagaacatgttgggtggcaagaaagttaaa
attatatttgttctaggtggtcctggaagtggaaaaggaactcagtgcagcaatattgta
gagcattttggttttatccatcttagcgctggtgaactcttgcgtgcagaaatcaattct
ggttcagagaacggaaccatgattgacactatcataacggaagggaaaatcgtcccatct
gagataaccataaagcttttgcaagaagccataataaaaggtggaaatgacaagtatatc
attgatggatttccacggaacgaagagaatcgtgttgtatttgagagtgttaccttggtt
acttacttccaactgcttcagataagcatatctcctgaatttgttctatttttcgattgt
tctgaggaagaaatggaaaggcgccttttgggtcgcaaccagggaagaagtgatgataac
attgagactatcaggaaaagattgaaagtttttgtagaatccagcttgcctgtcattgag
tattatgagtcaaaaggcatggttaagaaggtgtgtacatttgtaatggttatgcatgct
tcttgcagtacagtttattctccctaccggatttatagacttgtcatcatttaa

DBGET integrated database retrieval system