KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324478
Entry
4324478           CDS       T01015                                 
Name
(RefSeq) sec-independent protein translocase protein TATC, chloroplastic
  KO
K03118  sec-independent protein translocase protein TatC
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4324478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4324478
Secretion system [BR:osa02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   4324478
SSDB
Motif
Pfam: TatC
Other DBs
NCBI-GeneID: 4324478
NCBI-ProteinID: XP_015622519
UniProt: Q9AVE6
LinkDB
Position
1:complement(17341202..17346400)
AA seq 359 aa
MGSAGALLSHSPPGLGGFPPRHHHHHRLSVLRCVPLLPSPAPEPLSCRHGRHLRCAAVDG
GAGRETERPSPPAPQREESPSGSLGAALEDPSPQPVQNGSFGGITEDEEQSSLYNFLYPS
KELLPDDKEMSIFDHLEELRDRIFVSVLAVGAAILGCFAYSKDLIRILEAPVSVQGVRFL
QLSPGEFFFTTLKVSGYCGLLLGSPVILYEIIAFVLPGLTRDERKFLGPIVLGSSVLFYL
GIFFSYTVLAPAALNFFVNYADGAVESLWSIDQYFEFVLVLLFSTGLSFQVPVIQLLLGQ
VGLVSSDQMLSIWRYVVVGAVVAAAVLTPSTDPLTQMLLAGPLLGLYLGGAWMVKLTGR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggggagcgcgggggcgctgctctcgcactcgcctccggggctcggcggattccctcct
cgccaccatcaccaccaccgtctctccgtcctccgttgcgtaccgctcctcccctccccg
gcgcccgagcccctcagctgtcgccacggccggcaccttcgctgcgccgccgtcgacggg
ggagccggccgggagacggagcgtccctcgccgcccgcacctcagagggaggagtcgccg
tcgggcagcctcggcgcagccctcgaggacccatctcctcaacctgtccaaaatggatct
tttggaggtatcacagaggatgaagaacagagtagcctgtacaattttctttatccgagc
aaagagctacttcctgatgataaggagatgagtatatttgatcatctagaggaacttcgt
gacaggatatttgtctcagtattggctgttggtgctgcgatacttggttgtttcgcttac
tccaaagatcttattagaattctagaagcaccagttagtgttcagggtgttcggtttctg
cagctctctcctggagaatttttctttacaacattgaaggtctctggttattgtggcctt
ctacttgggagtcctgttattctgtatgagataatagcatttgttcttccgggtttaaca
agggatgaacgtaaattcctagggcccattgttctgggctcttctgtactattctacctt
ggcattttcttctcctacacggttcttgctcctgcagcattgaatttcttcgtgaactac
gcagatggggcagtggaatcgttatggtcgattgatcagtattttgagtttgtgcttgtg
cttttattcagcacaggattatcttttcaggtccctgttatccagctactgctggggcaa
gtcggtttggtttctagtgaccaaatgctttccatctggagatatgttgttgttggcgct
gtagttgctgctgctgtgcttacaccgtcgacagatccgttgactcagatgctcttggct
ggtccgctgcttggcctgtacttgggtggtgcttggatggtcaagctaactggtcgataa

DBGET integrated database retrieval system