KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324505
Entry
4324505           CDS       T01015                                 
Name
(RefSeq) aspartate--tRNA ligase, chloroplastic/mitochondrial
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4324505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4324505
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4324505
   03029 Mitochondrial biogenesis [BR:osa03029]
    4324505
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     4324505
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4324505
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4324505
 Prokaryotic type
   Other AARSs
    4324505
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4324505
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b DUF4443
Other DBs
NCBI-GeneID: 4324505
NCBI-ProteinID: XP_015622473
UniProt: B9ESX6
LinkDB
Position
1:2873590..2882675
AA seq 675 aa
MASSLLRASPLSLLSRLKPLNPSPTASHLRRLLLLSTASSTSSASCSPSPLRTLAATDAA
TPPPEEEAAAPAAEAKRERLQPLQWPARDALCGELGAGDAGRRVRLCGWVALHRAHAGLT
FLTLRDRSGTVQVTTLPEYPEVYAVVNKLRVESVVAVEGVVRSRPTEAINTDMKTGAIEV
AADNIYVLNSVTRSLPFPITTADTVKEKFPEEIRLRFRVLDLRRPQMQSNLRLRHNVVKH
IRRYLEDRHDFVEIETPVLSKSTPEGARDYLVPSRVQPGMFYALPQSPQLFKQMLMVSGF
EKYYQIARCFRDEDLRADRQPEFTQLDMEIAFTSMEDMLKLNEELMRHIFQEVGDIKLPN
PFPRLTYTEAMNRYGTDRPDLRFDWQLKDVSDAFLGSSFKIFADTLENGGVIKALCVPGG
AKEFSNTDLKKGTVYTEASKAGAKGLPFLKVMDNGELEGIGPLVASLKPEKKEQLLKHLD
AKSGDLILFALGEQSAANRILGRLRLFIAHKLEVIDTSAHSILWVTDFPMFEWNSDEQRY
EALHHPFTAPNPEDMNDLPSARALAYDMIYNGVEIGGGSLRIYKSDVQQRIFEIIGISPE
QAEEKFGYLLECFDMGAPPHGGIAYGLDRLVMLLAGENSIRDVIAFPKTTTAQCSLTKAP
SPVDPQQLKDLGFRT
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggcttcctctctcctccgcgcctcgccgctctccctcctctcccgcctaaagccgctc
aaccctagccccaccgcctcgcacctccgccgcctcctactgctctccaccgcctcctcc
acctcgtcggcctcgtgctcgccgtctccgctccgaaccctagcggccaccgacgcggcg
accccgccgccggaggaggaagcggcggcgcccgcggccgaggcgaagcgcgagaggctg
cagccgctgcagtggcctgcgagggacgcgctgtgcggcgagctcggcgccggtgacgcc
ggccgccgcgtgcgcctctgcggctgggtcgctctccaccgcgcccacgccggcctcacc
ttcctcacccttcgtgaccgatccggcacggtccaggtgacaactttgccagaatatcca
gaagtttatgctgtggtgaacaaactaagagtagagtcagtggttgcggtcgagggggtt
gttcggtcacgcccaacagaagccatcaacacagatatgaagactggggctatagaggtt
gctgcagataatatatatgtgctgaactcagtaactcgttcattgccttttccaatcacc
actgctgatactgtaaaagagaagtttccagaagaaattagactgagattccgggtgctg
gacttacgccgaccacaaatgcagtcaaacttgaggttgcgccataatgttgtcaagcat
attcgtcgatacttggaggatagacatgattttgttgagattgagactccagttttatct
aagtctacaccagaaggtgctcgggactatcttgtcccatcgagagttcagccaggaatg
ttctatgctcttcctcaaagccctcagctgttcaagcaaatgttgatggtctctggcttt
gaaaaatattatcagattgcaaggtgtttccgagatgaagatctgcgtgcagataggcaa
ccagagtttacacaacttgatatggagattgcatttacatcaatggaagatatgttgaag
ttgaacgaagaattaatgagacatattttccaagaggttggtgatatcaagctgccaaat
ccttttccaaggctaacctatacggaggcaatgaatcgctatggaacagataggcctgac
cttcgttttgattggcagctgaaagatgttagtgatgcatttttgggcagtagcttcaag
atttttgcagatacattagaaaacgggggtgtcatcaaggcattatgtgttcctggtggt
gccaaagaattttcaaatactgacctaaagaaaggaactgtctacactgaagcttccaaa
gctggagccaagggcctgccttttctcaaagttatggacaatggagagcttgaaggaatt
ggtccactcgtggcaagtctgaaacctgaaaagaaagagcagttgttgaaacatctagat
gcaaaatcaggtgatcttatcctgtttgcactgggtgagcaatcagcggctaatcgaatt
cttggcagattaagattatttattgctcataagctggaagtgatagatacatcagcacat
tcaattctttgggtgacggattttccaatgtttgaatggaacagtgatgagcagagatac
gaggcactacaccatcctttcactgcaccaaatcctgaagatatgaatgatctaccatca
gctcgagccttggcttatgacatgatttacaatggagtggagattggaggaggcagtttg
aggatatacaaaagtgatgtacaacaaaggatttttgagatcatcggtatctcacccgag
caggcagaggaaaaatttggctatcttttagaatgttttgacatgggtgctcctcctcat
ggaggaattgcctatgggttagatcgtttggtgatgcttttggctggtgaaaattcaatc
cgggatgtgattgctttcccaaagactacaactgctcaatgttcactcaccaaagcgcca
tctcctgtagatccacagcaattgaaggatcttggcttccgtacgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328255
Entry
4328255           CDS       T01015                                 
Name
(RefSeq) aspartate--tRNA ligase 2, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4328255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4328255
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4328255
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     4328255
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4328255
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4328255
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Other DBs
NCBI-GeneID: 4328255
NCBI-ProteinID: XP_015625477
UniProt: Q6Z2Y0
LinkDB
Position
2:2124901..2128505
AA seq 508 aa
MSTGDDDNHGDPLQQQPEEEDGGGYGDVAVGGGLFSVPGYEWADVAALGPDVAGRAVRVR
GAAHAVRAVGRRVAFLVLRQGSSTVQCVVGGGGGGGGGGDAGVARFAAGLSRESVVDVAG
VVSLPREPVRGTTQQEVEIQVKKLYCISKATPNLPISVDDAARSEEDVVKAKAAGEQLVH
VGQDKRLDFRVIDLRTPANQAIFRVQCEIENIFRQVLLSEGFVGIHTPKLIGGSSEGGAA
VFKLDYNGQPACLAQSPQLHKQMAICGGFERVFEVGPVFRAEDSNTHRHLCEFVGLDMEM
AIKGHYSEVCDVVDRLFVAMFDHLNKNCAKELEAINRQYPFKPLKYLPKTLRIEYDEGIR
MLKEAGVHVEAMGDLNTESEKKLGELVHTKYDTDFYMLCRYPSAVRPFYTMPCSDDPRYS
NSFDVFVRGEEIISGAQRVHVPEVLARQAEERGIDVGSIAAYVDAFRYGAPPHGGFGVGL
ERVVMLFCGLGNIRKASLFPRDPRRLNP
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtccaccggcgacgacgacaaccacggcgatccgctgcagcagcagccggaggaggag
gacggcggcggctatggcgatgtcgccgtcggcggggggttgtttagtgtccccggttac
gagtgggcggacgtggcggcgctggggccggacgtggccggccgcgccgtgcgcgtgcgg
ggcgcggcccacgcggtgcgcgccgtggggcggcgcgtcgcgttcctcgtgctgcggcag
gggtcgtccaccgtgcagtgcgtcgtgggtggcggcggcggcggcggcggaggaggagac
gccggggtggcgcggttcgccgccgggctgagccgggagtcggtggtggacgtcgccggc
gtcgtctcgttgccgcgggagcccgtccgcggcaccacgcagcaggaagtggagatccag
gtgaagaagctgtactgcatcagcaaagcgactccgaatctccccatcagcgtcgacgac
gcggcgcgaagcgaggaagacgtcgtgaaggccaaggctgccggcgagcagctcgttcat
gtcgggcaggacaagcgcttggacttcagagtgatcgacctgcgcacacctgcaaaccag
gcgatttttcgtgtccaatgcgaaatcgaaaacatcttcagacaagtgctgctgtcagaa
ggtttcgttggcatccacacgccgaagctgatcggcgggtccagtgaaggcggcgcggcg
gtgttcaagctggactacaacggccagccggcctgcctggcgcagtcgcctcagctccac
aagcaaatggcaatttgtggtggattcgagcgtgtgttcgaggttggccccgtgttcagg
gcagaagactccaacacgcaccggcatttgtgtgagttcgttggacttgacatggaaatg
gcaatcaaaggccactactctgaggtttgtgatgttgtggataggctgtttgttgctatg
tttgatcatctgaacaagaactgcgccaaggaacttgaggccattaacaggcagtatccg
ttcaaacctttgaagtacttacccaagacactgcgcattgagtatgacgaaggcatccgg
atgctcaaggaagctggggtccacgtggaggccatgggagacctcaacacagagtctgag
aagaagctgggcgagctggttcataccaagtatgacactgatttctacatgctctgccgg
tacccgtcggcggtgaggccattctacaccatgccctgctccgacgacccacgctacagc
aactccttcgacgtgttcgtccgaggggaggagatcatctcgggagcgcagagggtgcac
gtcccggaggtcctggcacgacaggcggaggagcgggggatcgacgtcggcagcatcgcc
gcctacgtcgacgcgttcaggtacggcgcgccgccgcacggcgggttcggcgtcgggctg
gagagggtggtgatgctcttctgcggcctcggcaacatcaggaaggcttctctcttccca
cgcgaccccaggaggctgaacccctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330354
Entry
4330354           CDS       T01015                                 
Name
(RefSeq) aspartate--tRNA ligase 2, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4330354
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4330354
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4330354
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     4330354
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4330354
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4330354
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d DUF3682 SUIM_assoc
Other DBs
NCBI-GeneID: 4330354
NCBI-ProteinID: XP_015625264
UniProt: Q0DYK4 Q6ZHC3
LinkDB
Position
2:28113637..28118740
AA seq 549 aa
MSSEPPPDAAAAAASSAGDLAADLSSATISKKQLKKDARKAEKAEKASQRQQQQQPQADA
DDPFAANYGDVPVEEIQSKTISGRVWTEIGGLDEAAAGRSVLIRGAAQAIRPVSKKMAFV
VLRESMSTVQCVLVASADAGVSTQMVRFATSLSKESIVDVEGVVSLPKEPLKATTQQVEI
QVRKIYCINRAIPTLPINLEDASRSEAEIEKAEQAGEKLVRVGQDTRLNYRAIDLRTPAN
QAIFRIQCQVENKFREYFLSKNFVGIHSPKLIAGSSEGGAAVFKLQYNGQPACLAQSPQL
YKQMAICGGFERVFEVGPVFRAENSNTHRHLCEFVGLDAEMEIKEHYFEVCDIIDGLFVA
IFKHLNENCKKELETINRQYPFEPLKYLEKTLKLTYEEGIQMLKEAGTEIEPMGDLNTEA
EKKLGRLVKEKYGTEFFILYRYPLAVRPFYTMPCYDNPAYSNSFDVFIRGEEIISGAQRI
HLPELLTKRATECGIDASTISSYIESFSYGAPPHGGFGVGLERVVMLFCALNNIRKTSLF
PRDPQRLVP
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtcgtcggagcctccacccgatgccgccgccgccgccgcctcctccgcgggggatctc
gcggccgatctctcctccgccaccatcagcaagaagcagctcaagaaggatgcgaggaag
gcggagaaggccgagaaggcgtcgcagcgccagcagcagcagcagccgcaggccgacgcc
gacgaccccttcgcggccaactacggcgacgtccccgtcgaggagatccagtccaagacc
atctccggccgcgtgtggaccgagatcggcggcctcgacgaggccgccgccggccgctcc
gtcctcatccgcggcgccgcgcaggcgatccggcccgtcagcaagaagatggccttcgtt
gtgctgcgcgagagcatgagcaccgtccagtgcgtgctcgtcgccagcgccgacgcaggg
gtcagcacccagatggtgcgcttcgccacctccctcagcaaggaatcaatcgtcgacgtc
gagggcgtcgtctccctccccaaggagcccctcaaggccaccacgcagcaggtggagatt
caggtgaggaagatctattgcatcaatagggcgatccccacccttccaatcaaccttgag
gatgcctcacggagtgaggctgaaattgaaaaggctgaacaagctggagagaagctagtt
cgtgtgggccaagatactcgcttgaactatagagctattgatctccggacacctgcaaat
caagcaatattcagaattcaatgtcaagttgagaacaaattcagggaatattttctgtcg
aaaaattttgttgggattcacagcccaaagctaattgctggatccagcgaaggtggtgca
gctgtattcaagctacagtacaatggacagccagcatgtttagcacagtctcctcagttg
tataagcagatggctatttgtggtgggtttgaacgtgtatttgaggttggacctgttttt
agagctgagaattcaaacactcacaggcatctgtgtgagtttgttggccttgatgctgag
atggagattaaggaacattattttgaggtttgcgacataatagatggtttgtttgtagca
atatttaaacacttgaatgaaaattgcaagaaagaactagagacaataaacaggcaatat
ccatttgaacctctgaagtatttagagaaaactttgaagctcacgtatgaagaaggaatt
caaatgctgaaggaagctggaacagaaatcgaacccatgggtgacctcaacactgaagct
gagaaaaaactaggccggcttgttaaggagaagtatggaacagaatttttcatcctctat
cggtatcctttggctgtgcgtcccttctacaccatgccttgttatgacaacccagcttac
agtaactcttttgatgtctttattcgaggagaggaaataatatctggagcacaaagaata
catttaccagagctattgacgaaacgtgcaacagagtgtggaattgatgcgagtactatt
tcatcatatatcgaatcgttcagctatggtgcacctcctcatggtggttttggtgtcggc
ctggagagggtggtaatgctgttctgcgccctaaacaacatcaggaagacatcacttttc
cctcgcgatccacaaaggctggtgccataa

DBGET integrated database retrieval system