KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324516
Entry
4324516           CDS       T01015                                 
Name
(RefSeq) very-long-chain enoyl-CoA reductase
  KO
K10258  very-long-chain enoyl-CoA reductase [EC:1.3.1.93]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4324516
   01040 Biosynthesis of unsaturated fatty acids
    4324516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4324516
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.93  very-long-chain enoyl-CoA reductase
     4324516
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4324516
SSDB
Motif
Pfam: Steroid_dh
Other DBs
NCBI-GeneID: 4324516
NCBI-ProteinID: XP_015621959
UniProt: A0A0P0UY87 Q5ZED1
LinkDB
Position
1:complement(2707638..2711452)
AA seq 310 aa
MKVSVVSRSGREVVRGGVELKDSAKVADLQDAIYAKTKKYYPARQRLTLPIQPGKSGKPV
VLSAKASLSEYCEKGSGSLTVVFKDLGPQVFYSTLFFFEYLGPLLIYPMFYYLPVYKYFG
YEGERVMHPVQTYAMYYWCFHYFKRIMETFFVHRFSHATSPVSNVFRNCAYYWTFGAYIA
YYCNHPLYTPVSELQMKIGFGFGILCQIANFYCHILLRNLRSPSGNGGYQIPRGFLFNIV
TCANYTTEIYQWLGFNIATQTVAGYIFLVVAASIMTNWALGKHRRLKKLFDGKEGRPKYP
RRWVILPPFL
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaaggtgtccgtcgtgtcccggagcggccgggaggtggtcaggggcggcgtcgagctc
aaggactcggctaaggtcgcggatctgcaggatgccatctatgccaagactaagaagtat
taccctgctaggcagcggctcaccctccctatccaacctggaaaatcaggaaagccagtt
gtccttagtgcaaaggccagcctatcagaatactgcgaaaagggttctggatccctgaca
gtggtctttaaggatttaggcccacaggtcttctacagcacgctgttcttctttgaatac
ttgggtcctcttcttatctaccccatgttctattacttgcctgtctacaaatatttcgga
tacgagggagagcgggtcatgcatcctgtccagacttacgccatgtactattggtgtttc
cactacttcaagaggatcatggagacgttctttgttcaccgcttcagccacgcgacttct
cctgtatcaaatgtcttcaggaactgtgcctactactggacctttggagcttacattgct
tactactgcaaccacccgctttacacccctgtgagtgaattgcagatgaagattgggttt
ggatttgggattctctgccaaattgcaaacttttattgccatatcctgctgaggaacctc
agaagtccgagtggtaacggtggctatcagattcctcgtggcttcctgttcaacatagtg
acatgcgcaaactataccactgagatctaccaatggcttgggttcaacattgccacacag
actgtggcaggttacatcttccttgttgtggcagcgagtatcatgaccaactgggcactt
ggaaagcaccgccgtctaaagaagttgttcgatggcaaggaagggaggccgaagtatcct
cggcgatgggtgattcttccaccattcctgtaa

DBGET integrated database retrieval system