KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324524
Entry
4324524           CDS       T01015                                 
Name
(RefSeq) inner membrane protein PPF-1, chloroplastic isoform X1
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4324524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4324524
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4324524
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    4324524
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4324524
SSDB
Motif
Pfam: 60KD_IMP DUF2062
Other DBs
NCBI-GeneID: 4324524
NCBI-ProteinID: XP_015640568
LinkDB
Position
1:2770145..2774208
AA seq 460 aa
MAKALLSSSLLPSLQPRAAAARLPMLTLPSLRRHGGRRASACRVRASLHGLDSIAGLDLH
AALERAEAALYTLADAAVVAADAAAGGGGGGGGGGGEAAASVAQKNGGWFGFISEALEVV
LKVLKDGLSAVHVPYSYGFAIILLTVIVKAATLPLTKQQVESTLAMQNLQPQIKAIQQRY
AGNQERIQLETARLYKQAGVNPLAGCFPTLATIPVWIGLYQALSNVANEGLLTEGFFWIP
SLGGPTTIAARQSGAGISWLLPFVDGHPPLGWHDTICYLVLPVLLVASQFVSMEIMKPPQ
TDDPSQKNTLLVLKFLPFMIGWFSLSVPSGLSIYWFTNNILSTAQQVWLRKLGGAKPVVN
QGGSGIITAGRAKRTSAQPAQPGERFKQLKEEESKRKGNKALAAGDSDLSASTSEDEESD
DETTEEQGGPEERYNSSSNKKLPNYSGKKGKRSKRKRMVQ
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggccaaggcgctcctctcctcgtcgctgctcccctcgctgcagccccgcgccgccgcc
gcgaggctgcctatgctgacgctgccttcgctgcggaggcacgggggccgccgcgcgtcg
gcgtgcagggtgagggcgagcctccacgggctcgactcgatcgcggggctcgacctccac
gccgcgctggagcgcgccgaggcggcgctctacacgctcgccgacgccgctgtcgtcgcg
gcggacgcggcggcgggaggaggagggggtggcggtggtggtggcggtgaagcggcggcg
tcggtggcgcagaagaacggggggtggttcgggttcatctccgaggccttggaggtcgtg
cttaaggtgctgaaggatggcctgtcagctgttcatgtgccgtactcttatggattcgcc
atcattcttctcactgttattgtgaaggctgcaacattacctttaacgaaacaacaggtc
gaatcaactctggctatgcagaatttacagccacagatcaaagcaattcaacagagatat
gcaggaaatcaggaaaggatacagcttgagactgctcggttatacaagcaagctggagtc
aaccctctggcaggatgttttccaactttggcaacaatacctgtctggattggcctctac
caagccctttcaaatgtagcaaacgagggattactgacagaaggatttttctggattcca
tctttgggaggccctacaacaattgctgctcggcaaagtggtgctggcatttcttggctc
ttgccttttgtggatggccatcctccattaggctggcatgacacgatatgttatcttgtg
ttgcctgtgctacttgttgcttctcagtttgtctctatggaaatcatgaagccaccccag
actgatgatccatcgcagaagaacacactgcttgttttgaaatttcttccatttatgata
gggtggttctctttgtcagtgccgtcagggttgtccatttattggttcacaaataatatc
ctcagcacagcccagcaagtttggttacggaaactgggaggagcaaagcctgttgtcaat
caggggggtagtgggataattactgcaggacgagcaaaacgtacgagtgctcaaccagcc
caacctggtgaaagatttaaacagctgaaagaagaggagagcaagagaaaaggcaacaaa
gcgcttgctgcaggagattcagatctttcagcctcaacatcagaggatgaagagtcggat
gatgagactactgaagagcagggaggacctgaggaaagatacaattccagtagcaacaag
aaacttccaaattactccggaaagaagggcaaaagatcaaagaggaagcgcatggttcag
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331399
Entry
4331399           CDS       T01015                                 
Name
(RefSeq) mitochondrial inner membrane protein OXA1-like
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4331399
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4331399
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4331399
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    4331399
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4331399
SSDB
Motif
Pfam: 60KD_IMP
Other DBs
NCBI-GeneID: 4331399
NCBI-ProteinID: XP_015628572
UniProt: A0A0P0VS81
LinkDB
Position
3:906052..909988
AA seq 418 aa
MAFSARRSLASGLSRHLSRRLHPSVSHLLPSHHDDHSENPSPPAQPPPLPSALRSPSRSQ
ALGLPLPFGLLHASRRSLSTSPRSNDELDASAEVLSDAASSVSVPADVLADAAASVPVSA
PAPFPGEVAAAAADSFAPVAALQHLIDGVHSLTGLNWWACIALTSLLIRTLTVPLLLNQM
KATVKLNAMRPEIEAINLEMRTSTDPQSMLEGKRKLGELFLRHGVTPLTPLKGLFIQAPI
FMSFFFAISNMVEKVPSFKGGGIYWFTDLTTPDELLILPMLTSLTFLVTVELNMQDGMEG
NPMLKTMKNFSRVMAVLTIPFTMSFPKAIFFYWVTSNLFSLGYGFVLRKPAVRSFLDLPP
IETQFAPAQQPTFNLFGASKSVPAAGSSIAESDRSSSVLSQRFSDLENRAKSRRESQD
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggctttctccgcgcggaggagcctcgcttccggcctctcccgccacctctcccgccgt
ctccacccctccgtctcccacctcctcccctcccaccacgatgaccactccgagaacccc
tcgccccccgcccaacctccgcctctcccctccgcgcttcgctcgccgtcgagatctcag
gcgctcggcctccccctccccttcggcctcctccacgcgtcccgccgcagcctctccacc
tcgccccgctccaacgacgagctcgatgcctccgcggaggtcctctctgacgccgcatct
tcggtctccgtcccggcggacgtcctcgcggacgccgcggcgtctgtacccgtctccgcc
ccggcgccgttccccggggaggtggccgcggcggccgccgactcgtttgcaccggtcgcc
gccctgcagcacctcatcgacggcgtccattccttgacggggctgaactggtgggcttgt
attgcgctcacgtcactgttgatccggacgctaactgtcccactgctgctgaaccagatg
aaggctacggtgaagctaaatgcaatgcggccagaaattgaagccattaatttggagatg
cgaacttcaactgatcctcagtcaatgctagaggggaaaaggaaattgggcgagctattt
ctaaggcatggcgtaactccactgacaccattgaagggtctattcatccaagcacctata
ttcatgagctttttctttgccatatcaaacatggttgagaaagttccttctttcaaagga
ggcgggatatattggtttactgatttgacaactcctgatgagcttttaattctcccaatg
ttgacatcgcttactttcttggttacggtagagttaaatatgcaagatggcatggaagga
aatcctatgttgaagacgatgaagaatttctctagagtaatggctgttttgactattcca
tttacgatgagctttcccaaggcaattttcttttactgggtcacatcgaacttgttctct
cttgggtatggttttgttcttcggaagccagctgtgaggagtttcttagatcttcctccc
atcgaaactcagtttgctccggctcaacagccgaccttcaacctttttggtgcatccaag
tcagtacctgcagcaggttcttctattgcagaatcagatcgatcaagttctgttctaagc
cagcggttcagcgatcttgaaaacagagctaaatcaagacgtgaatcccaagattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334759
Entry
4334759           CDS       T01015                                 
Name
(RefSeq) ALBINO3-like protein 1, chloroplastic isoform X1
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4334759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4334759
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4334759
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    4334759
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4334759
SSDB
Motif
Pfam: 60KD_IMP DUF2062
Other DBs
NCBI-GeneID: 4334759
NCBI-ProteinID: XP_015631158
UniProt: Q10AQ5 A0A8J8YKH3
LinkDB
Position
3:35511302..35517369
AA seq 510 aa
MDAHLLLLARPRALALAAARAPGGVAGFRRPASARRVAPRRVVLRPVAALGGGGGFAEVG
ELFGRVEAFLYTVADAAVSASPEVVQGGGGGTKEAAGDWLSGITNSMETVLKVLKDGLSA
LHVPYPYGFAIILLTVLVKAATFPLTKKQVESAIAMRSLQPQVKAIQERYAGDQERIQLE
TARLYKLSDVDPLAGCLPTLVTIPVWIGLYRALSNVANEGLLTEGFFWIPSLAGPTTIAA
RQSGQGISWLFPFTDGHPPLGWSDTLAYLVLPVLLVISQYVSSQVMQPPQNNDPSQQGAQ
AVVKFLPLLIGYFALSVPSGLSLYWLTNNILSTAQQVWLQKLGGAKNPVKEYIDKLAKEE
STNLGKPEPAIKSDPLPKVGKPPASQEPEPSGPQRGERFRKLKEEESRRKVFLEKAEQTE
QAGTQAGIVDGKQNSDASGDNIDEQESHENEPIIANGNGGLSHSTNEMIPNGSMKEDIIQ
ESTDSHSSVIDPTSHDAHKSRDEENEQDAV
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggacgcccacctcctcctcctcgcgcgcccgcgagccctagccctcgccgccgcgcga
gcccccggtggcgtcgccggcttcaggcggcccgcctcggcgcgccgggtggccccgcgc
cgcgtcgtacttcgaccggtggcggcgctggggggtggtggtggatttgcggaggtgggg
gagctgttcgggcgcgtcgaggcgttcctctacacggtcgcggatgcggccgtctcggcg
tccccggaggtggtgcagggaggcggcggggggaccaaggaggcggccggggactggctc
tccggcatcaccaactccatggagaccgtgctcaaggttttaaaagatggtctgtcagct
ctccatgttccttatccgtatggatttgcaatcatccttctaacagttctcgtcaaggca
gctacatttcctcttacaaagaagcaggttgagtctgcaattgcaatgaggtcactgcaa
cctcaagttaaggctattcaagaacgttatgctggtgatcaggaaaggatacagcttgaa
actgctcgtttatataagttgtcagatgttgacccgctcgcagggtgcttgcctactctt
gtgacaataccggtttggattggtctatacagagctctctccaatgtagctaatgaggga
cttcttaccgaaggctttttctggataccttctttggctggccctacaacaattgctgca
cggcaaagtggccagggaatatcatggctatttccctttacggatggtcatccacctctt
ggctggtcggacactctggcataccttgttttaccagttcttcttgttatttcccaatat
gtatcttctcaagtaatgcagccaccacagaacaatgatcctagccaacaaggtgctcaa
gctgtagtgaagttcctgcctttgctaattggttattttgctctctctgttccttctgga
ctaagtctatattggcttacgaataatatccttagcactgcacaacaagtatggcttcaa
aagcttggaggtgccaaaaatcccgtcaaagaatacattgataagctcgctaaagaagaa
tcaactaatcttggaaagcccgagcctgctattaagagtgatcctctccctaaagttggt
aaacccccggccagtcaagagccagaaccaagtggaccacaacgtggtgaaagatttaga
aaactaaaggaagaagagtcaaggagaaaagtgtttttggaaaaagcggaacagacagaa
caggcaggcacacaagctggcatcgtcgatggaaaacagaattcagatgcatctggagac
aacatagatgaacaggaatctcatgaaaatgaaccaattatagctaacggcaatggtgga
cttagccatagtacaaatgaaatgataccaaatggaagcatgaaagaggatataattcag
gaatcaactgacagccattcttcagttatcgaccctacgtcacatgacgctcataaatcg
agggacgaagagaacgaacaagatgcagtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349143
Entry
4349143           CDS       T01015                                 
Name
(RefSeq) mitochondrial inner membrane protein OXA1-like
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4349143
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4349143
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4349143
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    4349143
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4349143
SSDB
Motif
Pfam: 60KD_IMP DUF5799
Other DBs
NCBI-GeneID: 4349143
NCBI-ProteinID: XP_015612781
UniProt: Q8LNI1 A0A0N7KS34
LinkDB
Position
10:20166131..20171116
AA seq 413 aa
MAFAARRSLASRLSHHLTRRLHPATAPHLLASHSDDDPSPPPELPPFPHSPSPRHPRAGQ
ALDRHLLPFSLHHLAGLRRRGFSSAAGEVDAAAGVLADAAAAAEAVPAPFPGEVAAAAAD
SFFPVAALQHVIDYIHTFTGLNWWACIALATVLIRSATVPLLVNQLKATQKLNAIRPEME
AIKEEMNAMDPKSAKEGKAKMTALFQKHGVSPFTPLKGLLIQGPIFMSFFFAIRNMIDKV
PSMKGGGSLWFTDLTTPDPLYILPVLTALIFLVTVELNLQEGMEGNPMARKMKNFSRGMA
VLTVPFTMSFAKGIFCYWITSNLFTLTYGFVIRRPAVRKFCNLPALEAQSASAKKQMFNL
FGGSKALTTAESPVAITGGPQSSLEQPDAAALGYRVKNPEKKAKSRGKSRRRR
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcgttcgcggcgcggagaagcctcgcctcccgcctctcccaccacctcacccgccgc
ctccacccggcgacggcgccccacctcctcgcctcccactccgacgacgacccctcgccg
ccacccgagctcccaccattcccccactccccgtctccgcgccacccgcgggcgggccaa
gccctagaccgccacctcctccccttctccctccatcacctcgcggggctacgccgccgc
ggcttctcctcggccgccggcgaggtcgatgctgccgcgggcgtcctcgccgacgccgcg
gcggcggcggaggctgtgccggcgccgttcccgggggaggtggcggcggcggccgctgac
tcgttcttccccgtcgccgcgctgcagcacgtcatcgattacatccacaccttcaccggt
ctgaactggtgggcctgtattgcgctggcgacagtgctgatccggagcgcgaccgtgccg
ctattggtgaaccagttgaaggctacacagaagctaaatgcaataaggccagagatggaa
gccatcaaagaagaaatgaatgcgatggatccaaaatcagcaaaggaagggaaagctaaa
atgactgcactctttcaaaagcatggcgttagtccatttactccacttaagggactcctg
atccaagggccaatatttatgagttttttctttgctataagaaacatgattgacaaagta
ccatcgatgaaaggaggtggatcactttggtttactgatctaacaacaccggatcctctt
tacatccttccagttttaacggcattgatcttcttggtgacagttgagcttaacttgcaa
gaaggaatggagggaaatcctatggctagaaaaatgaagaacttttctagaggaatggct
gttttgacagtcccattcacaatgagttttgccaagggaattttctgttactggattaca
tcaaacttgttcactctgacatatggttttgttatccggcgaccggctgtgaggaaattt
tgtaatcttcctgctttggaagctcagtctgcatctgcaaagaagcaaatgttcaatcta
tttggtggatccaaggcattaactacagcagagtcacctgtagcaattacgggaggtccg
caatctagtttggagcaacctgatgctgctgctctgggctatcgggtcaaaaatcctgag
aagaaggcaaaatccagaggcaaatctcggaggcgcaggtaa

DBGET integrated database retrieval system