KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324542
Entry
4324542           CDS       T01015                                 
Name
(RefSeq) AMSH-like ubiquitin thioesterase 3
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4324542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4324542
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324542
   04121 Ubiquitin system [BR:osa04121]
    4324542
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4324542
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4324542
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Others
   Others
    4324542
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4324542
SSDB
Motif
Pfam: JAB USP8_dimer Prok-JAB
Other DBs
NCBI-GeneID: 4324542
NCBI-ProteinID: XP_015621980
UniProt: Q5QLJ2 A0A0P0V2Y3
LinkDB
Position
1:complement(17210271..17218305)
AA seq 518 aa
MSMPSSRQAMGEINIEAMARPVSVDHRISIAYYFRIADNLLRQANIYREEKNLVDLYIIL
LRYSSLLCETIPKHRDYHAFKLREKEFLKKGPHNSDKLLNVVNELETLKPVVLRQIADLN
RGVTQEPNSQSGTSAAISQMDHLTQSSCFTQPLVGSPTGLLKMPFSGGKHQVEPTQSGRP
DSQLVKSYGNLPYPKEETLSRHSVLGPNGLHGKWTAPVTGIRIQYPSNAELTKSDVSSLV
PSILNQDLLYGPSRSQDFPTNKNEDMQSVLSLDDGQLSLPVEEATSVSPGFEEEFSQLNI
RQPSPPPVMAQVHPQHRAISTSTVADLGPGIASSSTGRYQNLHVPVTLMECFLRVAEANT
ANNLETCGILAGTLKKRTFYVTTLIIPKQRSTSDSCQATNEEEIFEVQDKGSLFTLGWIH
THPTQTCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTTRKHGIFHLTDPGGMGVIHDCQE
SGFHPHEEPLDGTSIYEHCSHVYMNPNVKFDMVDLREL
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtccatgccatcatctcgccaagctatgggagaaatcaacatcgaggcgatggcacgc
ccagtctccgtcgaccaccgcatcagcatcgcctactatttccgcatcgccgacaacctc
ctccgccaggccaacatatatagggaggagaagaatctcgtagacctttacatcatcctt
ctgagatactcgagtttgctgtgtgagactatcccaaaacatcgtgattatcatgcattc
aagctacgagaaaaggaattcttgaagaaaggcccacacaattctgataaactcttgaat
gttgttaatgagcttgagactctgaagccagttgtgctacggcaaattgctgaccttaat
agaggggtcacacaagaacctaatagtcaaagtggaacctctgctgcaattagtcagatg
gatcatcttacccaaagttcatgtttcacacagccattggttggaagccctacaggatta
ttgaagatgccattctctggagggaagcatcaagtggaaccaacacaaagtggcagacct
gatagtcagcttgtcaaatcatatggcaatctgccttatcctaaagaagaaactctatcc
agacattcggtactggggcctaatgggcttcatggcaaatggacggcacctgttactggt
atcaggatccaatatccaagtaatgctgaactaaccaaaagtgatgtctctagtttagta
ccatcaatcttgaaccaagacctcttatatggtcctagtagatcacaagattttccaaca
aataaaaatgaggatatgcaatctgttttgtccctagacgatggccaattgtctttacca
gtagaggaggcaacctctgtgtctcctggttttgaagaagaattttcccagttgaatatc
aggcaaccttctcccccacctgtcatggcacaagtacatccacagcatagggcaatttct
acatcaacagttgctgatctggggccaggaattgctagttctagcactggacgctatcag
aatttgcatgtgccggtgacattaatggagtgttttctgagggttgctgaggcaaacact
gcaaataatctggaaacatgtggtattcttgctggtactctgaaaaagagaactttttat
gtgacaacactgataattcctaagcagagatcaacatctgattcatgtcaagctacaaat
gaagaagaaatatttgaagttcaggacaaaggctcacttttcactcttggttggattcat
acacatccaacacagacctgcttcctatcttccattgatcttcataatcactattcatac
caggtcatgcttcctgaagcaattgcaatagttatggcacctactgatacaacaagaaag
catggtatatttcatctgacggatccaggtggtatgggtgtgatacatgattgtcaagag
agtggatttcatcctcatgaggagcctctcgacggtacctctatctatgagcattgctcc
catgtgtacatgaacccaaacgtgaaatttgatatggtggatctccgtgaactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326798
Entry
4326798           CDS       T01015                                 
Name
(RefSeq) AMSH-like ubiquitin thioesterase 3
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4326798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4326798
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326798
   04121 Ubiquitin system [BR:osa04121]
    4326798
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4326798
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4326798
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Others
   Others
    4326798
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4326798
SSDB
Motif
Pfam: JAB USP8_dimer Prok-JAB
Other DBs
NCBI-GeneID: 4326798
NCBI-ProteinID: XP_015621755
UniProt: B9EW85 Q942M1
LinkDB
Position
1:13296319..13305267
AA seq 517 aa
MGPPQQARGGGIDIEACARPIAVDHRIKLPYYFRIAGNLLRQAKIYRDENNLVDLYVILL
RYSSLVCETIPKHRDYHTFKLREVDFFRLAPHNQSKLIEVLSELESLKPVVQRQITEHNR
ARGGAIESNSINGTIAVNNITKQHMTNPYTYQPFVGSNNGSFERPVPGGNHQMAPLMSAQ
PDRLTRKQLANLPFPKEETLARHSILGPNGLHGQWTGPVTAIKVQYPSNLDIIKSDVSSL
FPSVLNQDGQNGPSTISTDSTQIENDDMKSVLSLDDGRWSKLAEECASVPSVSLEEELSQ
LSIKQPSPPPVLAELERRPIAPSEVADPTPGLAVSETGRYQNLHVPVKLMECFLRVAEAN
TKRSLETCGVLAGTLKKRTFYVTALIIPKQKSTSDSCEATNEDELFDVQDKGSLFTLGWI
HTHPTQSCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTRRKHGIFHLSDPGGMGVIHDCP
ERGFHPHKAPLDGSPIYEHCSHVYMNPDVKFDVIDLR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggggccgccgcagcaggccaggggcggcggcatcgacatcgaggcgtgcgcgcgcccg
atcgccgtcgaccaccgcatcaagctcccctactacttccgcatcgccgggaacctcctc
cgccaggctaagatatatcgagacgagaataatctcgtcgacctgtatgtcatcctcctg
cgttactcgagcttggtttgcgagacgattccaaagcaccgtgactaccatacattcaag
ttgagagaagtggatttcttcaggcttgctccacataatcaatctaaactaattgaagtg
ctcagtgagcttgagtcactgaagccagttgtgcagcggcaaatcactgagcataacaga
gcaagaggaggtgccatcgaatccaatagtataaatggaaccattgctgtaaataatata
acaaaacagcatatgacaaatccttatacatatcagccatttgtaggaagcaacaatgga
tcatttgaaagacctgtccctggtgggaatcatcaaatggcaccattaatgagtgctcaa
cctgatagactgacccgcaaacaacttgcaaatctccctttccctaaagaagaaacatta
gctagacactctatattgggacctaatgggcttcatgggcaatggactgggcctgttact
gcaatcaaggttcagtatccaagcaatcttgatataataaaaagcgatgtgtctagttta
tttccatctgtcttgaaccaagatggtcagaatggtcccagtacaatatccacagatagc
actcaaattgagaatgatgatatgaaatctgttctgtcccttgatgatggtcgatggtct
aagctggcagaggaatgcgcctctgtaccttctgttagtctggaagaagaattatcccaa
ttgagtatcaaacagccttcacctcctccagtcttggcagagttagagcgcaggccaatt
gctccatcagaagttgcagatccaacaccaggacttgctgtctcagaaaccgggcgttat
cagaacttacatgttccggtaaagttgatggaatgttttctaagggttgctgaggcaaac
actaagagaagtttagaaacatgtggagttcttgctggtaccctgaaaaagagaaccttt
tatgtgactgccttgataattccaaagcagaaatctacatctgattcatgtgaagcgaca
aatgaagatgaattatttgatgttcaggacaagggctcgcttttcactcttggttggatt
cacacacatccaacacagtcctgcttcctgtcttccattgatctccataatcattattct
tatcaggtgatgttacctgaagcaattgcaatagttatggcacctactgacacaagaaga
aaacatggtatatttcatctctctgatcctggcggtatgggtgtgatccatgattgcccg
gagagaggattccatcctcataaggcccctctagatggttcaccaatttatgagcattgc
tcccatgtgtatatgaaccccgatgtaaagtttgatgtgattgaccttcgataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327852
Entry
4327852           CDS       T01015                                 
Name
(RefSeq) AMSH-like ubiquitin thioesterase 2 isoform X1
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327852
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4327852
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327852
   04121 Ubiquitin system [BR:osa04121]
    4327852
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4327852
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M67
   4327852
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Others
   Others
    4327852
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    4327852
SSDB
Motif
Pfam: JAB Prok-JAB
Other DBs
NCBI-GeneID: 4327852
NCBI-ProteinID: XP_015621203
LinkDB
Position
1:27008562..27012067
AA seq 282 aa
MGGRRVEINANKCGTHPTPSKPYYVDKIDTNEQKVVHYQVNCRPARDRNTGSYSVKHHYP
SPIVSWIEDLSSFGNVSFSQDPEYADEQSRSSVGQSSASVNLHDMQISVRLTDEFIELAK
ENTGNNVETCGILGASFRDGTYYVTMLIIPKQEATAHSCQAVSEEEIHAILSEQSLYPAG
WIHTHPSQTCFLSSIDLHTQYSYQVMLPEAVAIVIAPTDPTRNCGIFRLTDPGGMGVLRE
CSESGFHAHRETTDGGPIYETCSKVIFNPNLRFEIVDLRSAP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgggtggcaggagagttgaaatcaatgcaaataaatgtgggacgcatccaacgccaagt
aaaccatattatgtggataaaatcgataccaatgaacaaaaggttgtccactatcaagtt
aattgtagaccagcaagagatcgcaataccggttcctactctgtgaagcaccattaccca
tctcctattgtttcttggatagaagacctttcgagcttcggcaatgtttcttttagccag
gatcctgaatatgctgatgagcaatcaagatcttcagtggggcagtcttcagcatctgtc
aatttgcatgacatgcagatatcagttagattgacagatgaattcatcgaacttgcaaag
gagaatacaggcaacaatgtagagacttgtggaatcctaggtgcttcatttagagatggg
acttactatgtgactatgttgatcataccaaagcaagaagcaactgctcattcttgccag
gctgtcagtgaggaggagatacatgctattttatcggagcaatcactttaccctgcaggg
tggatacatacacacccttcacaaacgtgtttcttatcatcaattgatctgcacactcaa
tactcctaccaggttatgttaccagaggccgttgcgattgtgattgctcccactgatcct
actaggaactgtggaatattcaggctgacagacccaggagggatgggtgtgcttagggag
tgcagtgaaagtgggttccacgcccaccgggagacaacggacggcggcccaatctatgaa
acctgctccaaggttatattcaacccaaatttgaggttcgagattgttgacctgcgttcc
gctccctga

DBGET integrated database retrieval system