KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324553
Entry
4324553           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S10-like
  KO
K02947  small subunit ribosomal protein S10e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4324553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4324553
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4324553
SSDB
Motif
Pfam: S10_plectin
Other DBs
NCBI-GeneID: 4324553
NCBI-ProteinID: XP_015623648
UniProt: Q0JFT4 A3A1S7
LinkDB
Position
1:complement(42425152..42427384)
AA seq 179 aa
MIISKKNRREICKYLFHEGVLYAKKDYNLAKHPKVDVPNLEVIKLMQSFKSKEYVRETFS
WQHYYWYLTNDGIEHLRSYLNLPSEVVPNTLKKSAKPPSRPFGSGPPGDRPRGPPRFEGD
RPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRGSRPGFGRGGGGAFGGGASSME
NT seq 540 nt   +upstreamnt  +downstreamnt
atgatcatctccaagaagaaccgccgcgagatctgcaagtacctcttccatgagggagtc
ttgtatgccaagaaggactacaacctggccaagcacccaaaggttgatgtgcccaacttg
gaggtgattaagctcatgcagagcttcaagtcaaaggagtatgtgagggagaccttctcg
tggcagcactactactggtacctgaccaatgatggcattgagcacctccgcagctacctc
aacctgccatctgaggttgtgcctaacaccctcaagaagtctgccaagcccccgtctcgc
ccattcggctctggccctcctggtgaccgccccagaggcccgcctcgctttgagggtgac
aggcccaggtttggtgacagggatggttacaggggtggcccacgtggtgctccaggtgat
tttggtggcgagaagggtggtgctccagctgagttccagccatcttttaggggtagcaga
cctggctttggtcgtggcggtggtggcgcattcggtggtggcgcatcttccatggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329619
Entry
4329619           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S10
  KO
K02947  small subunit ribosomal protein S10e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329619
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4329619
SSDB
Motif
Pfam: S10_plectin
Other DBs
NCBI-GeneID: 4329619
NCBI-ProteinID: XP_015623121
UniProt: P0DKK8 P0DKK9
LinkDB
Position
2:20649507..20651975
AA seq 183 aa
MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQIDVPNLQVIKLMQSFKSKEYVRETFS
WQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARPPGRPFGSGPPGDRPRGPPRFEGD
RPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRSSGGRPGFGRGGGGGFGAGPTSS
SME
NT seq 552 nt   +upstreamnt  +downstreamnt
atgatcatccccaagaagaaccggaatgagatctgcaagtacctcttccaagagggggtt
ttgtacgccaagaaggactacaatttggcaaaacacccacagattgatgtgccaaacctt
caggtcatcaagctcatgcagagcttcaagtccaaggagtatgtcagggagaccttctcc
tggcagtactactactggtacctcactaatgatggcattgagcacctgaggaattacctt
aacttgccgtctgagattgtacctgctacactcaagaagtctgcaaggccaccaggccgc
ccatttggctctggcccccctggtgatcgcccaaggggcccacctcggttcgaaggggac
agaccaaggtttggagaccgggatggctaccgtggtggacctcgtggtgcgcctggtgat
tttggtggtgagaagggtggtgctcctgcagaattccagccatcattcaggagttctggt
ggtagacctggctttggacgcggtggcggcggtggtttcggtgctggtccaacctcttcc
tccatggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335865
Entry
4335865           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S10
  KO
K02947  small subunit ribosomal protein S10e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4335865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4335865
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4335865
SSDB
Motif
Pfam: S10_plectin
Other DBs
NCBI-GeneID: 4335865
NCBI-ProteinID: XP_015636412
UniProt: P0DKK8 P0DKK9
LinkDB
Position
4:21329561..21332172
AA seq 183 aa
MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQIDVPNLQVIKLMQSFKSKEYVRETFS
WQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARPPGRPFGSGPPGDRPRGPPRFEGD
RPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRSSGGRPGFGRGGGGGFGAGPTSS
SME
NT seq 552 nt   +upstreamnt  +downstreamnt
atgatcatcccgaagaagaaccgcaatgagatctgcaagtacctcttccaagagggagtg
ctgtatgccaagaaggactacaacctggcgaagcacccgcagatcgatgtgccgaacctg
caggtgatcaagctcatgcagagcttcaagtccaaggagtacgtcagggagaccttctcc
tggcagtactactactggtacctcaccaacgatggcattgagcacctgcgcaactacctt
aacctgccatctgagattgtgcctgccacactcaagaagtctgccaggccacctggccgc
ccatttggttctggcccacctggcgaccgcccaaggggcccgcctcgctttgaaggggac
aggccaaggtttggtgacagagatgggtaccgtggtggtcctcgtggtgctcctggtgac
tttggtggtgagaagggtggagctcctgctgagttccagccatcctttaggagctctggt
ggcagacctggctttggccgtggtggtggcggaggctttggcgctggcccgacctcttcc
tcgatggagtga

DBGET integrated database retrieval system