KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324597
Entry
4324597           CDS       T01015                                 
Name
(RefSeq) inorganic pyrophosphatase 3
  KO
K13248  pyridoxal phosphate phosphatase PHOSPHO2 [EC:3.1.3.74]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00750  Vitamin B6 metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4324597
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4324597
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.74  pyridoxal phosphatase
     4324597
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4324597
SSDB
Motif
Pfam: Put_Phosphatase HAD
Other DBs
NCBI-GeneID: 4324597
NCBI-ProteinID: XP_015613977
UniProt: A2ZV38
LinkDB
Position
1:complement(23583996..23585683)
AA seq 284 aa
MAAGVDGDTAAAAAAGGGVVVVFDFDRTIIEWDSDDWVITKLGASDAFRRLRPTMRWNPL
MDRMMVELHAQGRSADDIRDCLKSAPLDAHVLSAITTASALGCDLRVASDANAFFIETVL
EHHGVLGCFSEISTNPARVDGNGRLRISPFHDPDDSSPHGCSLCPENMCKGKIIERIQAT
ANGKRHFIYIGDGRGDYCPSLKLGEGDYVMPKEKYPLWNLISSNKQLLKAEVHPWNNGEE
LEQTLLKLVNKLITPPAQPSQFEYKCDMSNPVSTEVGQALRVPH
NT seq 855 nt   +upstreamnt  +downstreamnt
atggccgctggcgttgacggcgacacggccgccgccgccgccgccggaggcggggtggtg
gtggtgttcgacttcgacaggaccatcatcgagtgggacagcgacgactgggtcatcacc
aagctcggcgcctccgacgcctttcgccgcctccgccccaccatgcgctggaaccccctc
atggacaggatgatggtggagctgcacgcccaggggaggtcggccgacgacatccgcgac
tgcctcaagagcgcccccctcgacgcccacgtcctctccgccatcaccacggcctcggca
ttagggtgtgatttgagggtggcgagcgacgccaacgccttcttcatcgagaccgtgctg
gagcaccacggcgtcctcggatgcttctcggagatcagcacgaacccggcgcgcgtcgac
ggcaacggcaggctgaggatctcgccgttccacgaccccgacgacagctcgccccatgga
tgcagcctctgccccgagaacatgtgcaagggcaagataattgagaggattcaggcgacg
gccaatggtaaaaggcatttcatctacattggtgatggcagaggagattattgcccctcc
cttaagctaggggaaggggactatgtcatgccaaaggagaaataccccctctggaatctc
atcagcagcaacaaacagcttctcaaggccgaggttcatccatggaataatggcgaggaa
ctcgaacagaccttacttaagttggtcaacaagttgatcaccccacctgcacaaccatcc
caatttgaatataaatgtgatatgagcaatccagtatccactgaagtaggacaggctctt
cgtgtgccacattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328780
Entry
4328780           CDS       T01015                                 
Name
(RefSeq) inorganic pyrophosphatase 2
  KO
K13248  pyridoxal phosphate phosphatase PHOSPHO2 [EC:3.1.3.74]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00750  Vitamin B6 metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4328780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4328780
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.74  pyridoxal phosphatase
     4328780
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4328780
SSDB
Motif
Pfam: Put_Phosphatase HAD Hydrolase Poly_export
Other DBs
NCBI-GeneID: 4328780
NCBI-ProteinID: XP_015624007
UniProt: A0A0N7KEY8 Q6H6J4
LinkDB
Position
2:7078564..7080042
AA seq 296 aa
MAASGGGNGVVVVFDFDKTIIDCDSDNWVVDALGATARFDDLLCRLPWNSAIDAMMGELH
AEGRTVEEVAASLRAAPLSPRVAAAVETARALGCELRVLSDANAFFVGAVLDHHGLAGCF
SAVDTNPAAVDADGRLRILPYHGLPGHGCPLATCPPNMCKGKVMERIIDELSCGCGGALA
ARRRRVVYVGDGRGDYCPSLKLTEMDYVMPRKGYPVWDLIAGGDRAAVRADVREWADFED
LEAVLLGIVAECLTSEHDDADDDGGEAAPPAECRALPATLASGQEAILPKAVHVPN
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcggcgagcggcggcggcaatggcgtggtggtggtgttcgacttcgacaagaccatc
atcgactgcgacagcgacaactgggtcgtcgacgcgctcggcgccaccgcccgcttcgac
gacctcctctgccgcctcccctggaactccgccatcgacgccatgatgggggagctgcac
gcggaggggaggacggtggaggaggtggcggcgagcctgagggcagcgccgctgtcgccg
cgcgtggcggcggccgtcgagacggcgcgcgcgctcgggtgcgagctcagggtgctcagc
gacgccaacgccttcttcgtcggcgccgtcctcgaccaccacggcctcgccggctgcttc
tcggcggtcgacaccaacccggccgccgtcgacgccgacggccgcctccggatcctcccc
taccacggcctccccggccatggctgccccctcgccacctgccctcccaacatgtgcaag
ggcaaggtcatggagaggatcatcgacgagctatcctgcggctgcggtggcgcgctggcg
gcgaggaggaggagggtggtgtacgtcggcgacgggagaggcgactactgcccgtcgctg
aagctgacggagatggactacgtgatgccgaggaaggggtacccggtgtgggacctcatc
gccggcggcgaccgcgccgccgtccgggccgacgtccgcgagtgggcggacttcgaggac
ctcgaggcggtgctgctcggcatcgtcgccgagtgcctcacgtcggaacacgacgacgcc
gacgacgatggcggcgaggcggcgccgccggcggagtgccgtgcgctgccggcgacgctg
gcttccggtcaggaggcaattctgcccaaggcagttcacgtgcctaattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352717
Entry
4352717           CDS       T01015                                 
Name
(RefSeq) pyridoxal kinase isoform X1
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00750  Vitamin B6 metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4352717
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     4352717
SSDB
Motif
Pfam: Phos_pyr_kin PfkB
Other DBs
NCBI-GeneID: 4352717
NCBI-ProteinID: XP_015619979
LinkDB
Position
12:25271493..25277027
AA seq 356 aa
MTAVAVPSPPLLHPTCPSWWSSPRPSFFFFFLREERWLLRRRRTAMARPPVLSVALPSDT
GRVLSIQSHTVQGYVGNKSAVFPLQLLGFDVDPINSVQFSNHTGRGYPTFRGQVLNGSQL
WDLIEGLAENDLLHYTHLLTGYIGSVSFLTTVLQVVDKLRSVNPDLVYVCDPVLGDEGKL
YVPQDLISVYQQKVVPVATMLTPNQFEVELLTGLRITCEEDGLKACNALHSAGPRKVVIT
SALIEDKLLLIGSHKKAKEQPPEQFKIEIPKIPAYFTGTGDLTTALLLGWSNKYPDNLER
AAELAVSSLQALLRRTVEDYKRAGFDPSTSSLEIRLIQSQDEIRRPQITCKAVKYS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaccgccgtcgccgtgccgtcgccgccgctcctccaccccacgtgcccctcgtggtgg
tcgtccccgcgccccagcttcttcttcttcttcctgagggaggagaggtggttgctgcgg
cggcggaggacggcgatggcgcggccgccggtgctctccgtcgcgcttccctccgacacg
ggacgcgtgctcagcatccagtcccacaccgtccagggatacgttggcaacaaatcagca
gtctttcccctgcaactcctgggctttgatgtggatccgataaactcggtacagttttct
aatcatacaggtagagggtacccaacatttagaggacaggtcctcaacggcagtcagctg
tgggatcttattgaagggctggcggaaaacgatttattgcattatacccatttattaaca
ggttatattggatctgtttcctttttaactactgtactacaagttgttgacaaattacga
tcagtcaatcctgatcttgtatatgtttgtgacccggttctaggtgatgaagggaaacta
tatgtccctcaggatttaatatctgtttatcaacagaaggttgtcccagttgctacaatg
cttacacctaaccaatttgaagttgaactactcactggtttaaggattacctgtgaagaa
gatggcttgaaagcttgcaatgcgctacatagtgctggaccgcgaaaggtggtaataact
agtgcacttattgaagataagctgctcctcattggaagccacaaaaaagcaaaggaacaa
ccaccagaacaatttaagattgagatacccaagatacctgcatatttcacgggcactgga
gatttaacaactgcccttctactaggatggagtaataaataccctgataaccttgagagg
gcggctgaactggcggtatccagtttgcaggcactcctaaggagaactgtggaagactat
aaaagagctgggtttgacccctccaccagcagcctagagatccgcttgattcaaagccag
gatgaaattcgaaggccccagattacatgcaaggctgtgaagtatagctga

DBGET integrated database retrieval system