KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324599
Entry
4324599           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein 2, chloroplastic
  KO
K08912  light-harvesting complex II chlorophyll a/b binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4324599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4324599
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4324599
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4324599
NCBI-ProteinID: XP_015621226
UniProt: P12331 I3QD41
LinkDB
Position
1:23607346..23608505
AA seq 261 aa
MAAATMALSSPALAGKAAAKVFGEGRITMRKSAAKPKPAASGSPWYGADRVLYLGPLSGE
PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVK
FGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEV
VDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLAD
HLADPVNNNAWAYATNFVPGK
NT seq 786 nt   +upstreamnt  +downstreamnt
atggccgccgccaccatggccctctcgtccccggcgctggccggcaaggccgccgcgaag
gtgttcggcgaggggcgcatcaccatgcgcaagtcggcggcgaagcccaagcccgccgcg
tcggggagcccgtggtacggcgccgaccgcgtgctctacctcggcccgctctccggcgag
ccgccgagctacctgaccggcgagttccccggcgactacgggtgggacaccgcggggctc
tccgccgacccggagacgttcgccaagaaccgggagctggaggtgatccactccaggtgg
gcgatgctcggcgcgctgggctgcgtgttcccggagctcctcgcccgcaacggcgtcaag
ttcggcgaggcggtgtggttcaaggcggggtcgcagatcttcagcgagggcgggctcgac
tacctcggcaacccgagcctgatccacgcgcagagcatcctcgccatctgggcggtccag
gtggtgctcatgggcgccgtcgaggggtaccgcatcgccggcgggccgctcggcgaggtc
gtcgacccgctctaccccggcggcagcttcgacccgctcggcctcgccgacgacccggag
gccttcgcggagctcaaggtgaaggagatcaagaacggccgcctcgccatgttctccatg
ttcggcttcttcgtccaggccatcgtcaccggcaagggccccctcgagaacctcgccgac
cacctcgccgaccccgtcaacaacaacgcctgggcctacgccaccaacttcgtccccggc
aagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324705
Entry
4324705           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein of LHCII type 1
  KO
K08912  light-harvesting complex II chlorophyll a/b binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4324705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4324705
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4324705
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4324705
NCBI-ProteinID: XP_015648289
UniProt: A0A8J8YC10 Q8W0E6
LinkDB
Position
1:30030985..30032087
AA seq 265 aa
MAASTMALSSPAALAGKAVANAKVFGEGRVTMRKSAAKPKPAAASGSPWYGADRVLYLGP
LSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR
NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWGCQVVLMGAVEGYRVAGGP
LGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE
NLADHLADPVNNNAWAYATNFVPGK
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcggcgtccaccatggcactctcctcccctgccgccctcgccggcaaggcggtcgcc
aatgccaaggtgttcggcgagggccgcgtcacgatgcgcaagtcggcggccaagcccaag
cccgccgcggcgtcggggagcccgtggtacggcgccgaccgcgtgctctacctcggcccg
ctctccggcgagccgccgtcctacctcaccggcgagttccccggcgactacggctgggac
accgccgggctgtcggccgacccggagacgttcgccaagaaccgggagctggaggtgatc
cactgccggtgggccatgctgggcgcgctcggctgcgtcttcccggagctcctcgcccgc
aacggcgtgaagttcggcgaggccgtgtggttcaaggcggggtcccagatcttcagcgag
ggggggctcgactacctcggcaaccccagcctgatccacgcgcagagcatcctggcgatc
tggggttgccaggtcgtgctcatgggcgccgtcgaggggtaccgcgtcgccggcggcccg
ctcggcgaggtcgtcgacccgctctaccccggcggcagcttcgacccgctcggcctcgcc
gacgaccccgaggcgttcgccgagctcaaggtgaaggagatcaagaacggccgcctcgcc
atgttctccatgttcgggttcttcgtccaggccatcgtcaccggcaaggggccactggag
aacctggccgaccacctcgccgaccccgtcaacaacaacgcatgggcctacgccaccaac
ttcgtccccggcaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346803
Entry
4346803           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein 1, chloroplastic
  KO
K08912  light-harvesting complex II chlorophyll a/b binding protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4346803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4346803
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4346803
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4346803
NCBI-ProteinID: XP_015611833
UniProt: P12330 A0A1L2JKJ9
LinkDB
Position
9:10845683..10846965
AA seq 265 aa
MAAATMALSSPVMARAAPSTSSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYLGP
LSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAR
NGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGP
LGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLE
NLADHLADPVNNNAWAYATNFVPGK
NT seq 798 nt   +upstreamnt  +downstreamnt
atggccgcggccaccatggcgctctcctccccggtgatggcccgcgcggcgccgtcgacc
tcctccgcgctcttcggcgaggcgcggatcaccatgcgcaagaccgccgcgaagcccaag
ccggcggcgtcgtcggggagcccgtggtacggcgccgaccgcgtcctctacctcggcccg
ctctccggcgagccgccgagctacctcaccggcgagttcccgggcgactacgggtgggac
accgcggggctctccgccgacccggagacgttcgccaagaaccgggagctggaggtgatc
cactcccggtgggcgatgctgggcgcgctcggctgcgtcttcccggagctcctcgcccgg
aacggcgtcaagttcggcgaggccgtgtggttcaaggcgggctcgcagatcttcagcgag
ggcgggctcgactacctcggcaacccgagcctgatccacgcgcagagcatcctcgccatc
tgggcggtgcaggtggtgctcatgggcgccgtcgaggggtaccgcatcgccggcgggccg
ctcggcgaggtcgtcgacccgctctaccccggcggcgccttcgacccgctcggcctcgcc
gatgaccccgaggcgttcgcggagctcaaggtgaaggagatcaagaacggccgcctcgcc
atgttctccatgttcggcttcttcgtccaggccatcgtcaccggcaagggccccctcgag
aacctcgccgaccacctcgccgaccccgtcaacaacaacgcctgggcgtacgccaccaac
ttcgtccccggcaagtga

DBGET integrated database retrieval system