KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324623
Entry
4324623           CDS       T01015                                 
Name
(RefSeq) ras-related protein RIC2-like
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4324623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324623
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324623
   04031 GTP-binding proteins [BR:osa04031]
    4324623
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4324623
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4324623
  Exosomal proteins of colorectal cancer cells
   4324623
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4324623
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_16 AAA_22 PduV-EutP Gtr1_RagA AAA_21 ABC_tran AAA_24 AAA_29 AAA_14
Other DBs
NCBI-GeneID: 4324623
NCBI-ProteinID: XP_015647580
UniProt: Q94J09 A0A8J8YD97
LinkDB
Position
1:31403703..31407263
AA seq 221 aa
MAAGGGGGYRAEDDYDYLFKTVLIGDSGVGKSNLLSRFTKNEFCLESKSTIGVEFATRSI
QVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFDNVARWLKELRDHT
DPSIVVMLVGNKSDLRHLVAVSTEDGKEYAEAESLYFMETSALDATNVENAFAEVLTQIY
QTVSKKTVEASDDGSNAPIKGEKINVKDDVSALKRIGCCSN
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcggcgggcggaggcggcggctacagggcggaggacgactacgactacctgttcaag
acggtgctcatcggcgactccggcgtgggcaagtccaacctgctgtcgcgtttcaccaag
aacgagttctgcctcgagtccaagtccaccatcggggtcgagttcgccacccgcagcatc
caggtcgacggcaaggtcgtcaaggcccagatttgggacaccgccggccaggagagatac
cgtgctattacaagtgcctattacagaggagcagtaggtgcactgcttgtctatgatgtc
actcggcgtgctactttcgataatgtggcacgctggctaaaagagctgagagaccacact
gaccctagtattgttgtcatgctagtaggcaacaaatccgatctccgccatctggtggct
gtttcaactgaagatggaaaggaatatgctgaggctgagtcattgtacttcatggagaca
tctgcattagacgccacaaatgtagagaatgcttttgcagaagttttgactcagatatac
caaactgtcagcaagaagacggttgaggcatcagatgatggatcaaatgctccaatcaaa
ggagagaagattaatgtgaaagatgacgtgtctgcgctgaagagaattggctgttgctca
aattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324856
Entry
4324856           CDS       T01015                                 
Name
(RefSeq) ras-related protein Rab2BV
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4324856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324856
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324856
   04031 GTP-binding proteins [BR:osa04031]
    4324856
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4324856
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4324856
  Exosomal proteins of colorectal cancer cells
   4324856
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4324856
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA AAA_14 TniB AAA_22 AAA_16 AAA_24 ABC_tran PduV-EutP NTPase_1 AAA_18
Other DBs
NCBI-GeneID: 4324856
NCBI-ProteinID: XP_015624957
UniProt: A2ZZK2 Q941S7
LinkDB
Position
1:complement(36467915..36470470)
AA seq 216 aa
MAHRVDNEYDYLFKIVLIGDSGVGKSNILSRFTRNEFFLESKSTIGVEFATRTLQIEGKT
IKAQIWDTAGQERYRAITSAYYRGAVGALLVFDITKRQTFDNVQRWLRELRDHADANIVV
MMVGNKSDLNHLRSVPEEDGHAFSEKEGLSFLETSALEAINVEKAFHTVLSEIHQIVSKK
ALAAQESASTNGRSMQGTTINVAEAPAATKGSCCSS
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgcaccgggtggacaacgagtacgactacctgttcaagatcgtcctcatcggcgat
tccggcgtcggcaagtccaacatcctctcccgcttcacccgcaacgagttcttcctcgag
tccaagtccaccatcggcgtcgagttcgccacccgcaccctgcagatagaagggaagact
atcaaggctcagatatgggacacggcaggtcaagagagataccgtgcaatcacgagtgct
tattacaggggtgcagttggagcacttcttgtattcgacataacaaagaggcaaaccttc
gacaatgttcagaggtggctgcgggagctccgggaccatgcagacgccaacattgttgtc
atgatggtcggaaacaagtctgacttaaaccatctacgatcagtccccgaggaagatggc
catgcgttctctgagaaagaaggtctctccttccttgagacgtctgctctggaagcgatt
aatgtggagaaagcattccatactgtattgagtgaaattcaccagattgtaagcaagaaa
gcacttgcagctcaggaatccgcgtctacaaatgggcgttccatgcaaggaactacgatc
aacgttgctgaagctccagccgccacaaaaggttcttgctgttctagttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334619
Entry
4334619           CDS       T01015                                 
Name
(RefSeq) ras-related protein Rab11C
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334619
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334619
   04031 GTP-binding proteins [BR:osa04031]
    4334619
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4334619
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4334619
  Exosomal proteins of colorectal cancer cells
   4334619
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4334619
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA AAA_16 TniB AAA_22 ABC_tran PduV-EutP AAA_7 NTPase_1 AAA_24 AAA_14 FeoB_N
Other DBs
NCBI-GeneID: 4334619
NCBI-ProteinID: XP_015632229
UniProt: Q0DM80 Q852B4
LinkDB
Position
3:complement(34593290..34596542)
AA seq 215 aa
MAHRVDNEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQIEGQT
IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKKQTFENIQRWLRELRDHADSNIVI
MMVGNKSDLNHLRSVPEEDGQALAEKEGLSFLETSALEALNVEKAFQTILKDIHQIISKK
ALAAQEAAGSGPPTQGTTINVTDSAVNTKRGCCSS
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcgcaccgggtggacaacgagtacgactacctcttcaagatcgtgctcatcggcgac
tccggcgtcggcaagtccaacatcctctcgcgattcacccgcaacgagttctgcctcgag
tccaagtccaccattggcgtcgagttcgccacccgcacgctccagatagaagggcagacc
atcaaagctcagatatgggatactgctgggcaggagaggtaccgtgcaatcacaagtgct
tactaccggggagctgtgggggcacttctagtctatgacataacaaagaagcagacgttt
gaaaacatccagaggtggcttcgtgaacttcgtgatcatgcggactccaacattgtcatt
atgatggtaggcaacaaatcagaccttaaccacctgagatcagttccagaggaagatggt
caggcactagcagagaaggaaggtctatcattcctcgagacctcagctctggaagccctt
aatgttgagaaggcatttcagactatccttaaagatattcatcaaatcatcagcaagaag
gcacttgctgcccaagaggcagcaggcagtggacctcccactcaaggaaccaccatcaat
gttactgattctgctgttaacacaaagagaggatgctgttcttcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334746
Entry
4334746           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABA2a
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334746
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334746
   04031 GTP-binding proteins [BR:osa04031]
    4334746
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4334746
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4334746
  Exosomal proteins of colorectal cancer cells
   4334746
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4334746
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU Gtr1_RagA PduV-EutP FeoB_N AAA_22 AAA_16 AAA_14 AAA_24 AAA_21 MCM ABC_tran NTPase_1 TniB
Other DBs
NCBI-GeneID: 4334746
NCBI-ProteinID: XP_015629707
UniProt: B9F7J1 Q75LE2
LinkDB
Position
3:complement(35432785..35434620)
AA seq 223 aa
MARRPAPWEQGGDEYDYLFKIVLIGDSGVGKSNLLSRFTRNSFSLDSKSTIGVEFATRTI
QVEGKIVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTKATTFENVKRWLKELRDHA
DSNIVVMLIGNKIDLKHLRSVSLEDATSFAEREGLSFVETSALDATNVDKAFQTVLTEIY
RIISKKALAADEAGAGAGAVREGQSIQVSATDSSSFTSRCCSF
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctcggcggccggcgccgtgggagcagggcggcgacgagtacgactacctgttcaag
atcgtgctgatcggggactccggcgtggggaagtcgaacctcctctcccgcttcacccgc
aacagcttctccctcgactccaagtccaccatcggcgtcgagttcgccacccgcaccatc
caggttgaaggaaagattgtaaaggcacagatatgggacacagccgggcaagaacggtac
cgggccatcacaagcgcatactaccgcggcgcagtgggagcattgctagtctatgatgtc
acaaaggccacaacttttgagaatgtgaagaggtggctcaaggagctccgtgaccatgcc
gactccaacatcgtcgtcatgctcatcggcaacaagatcgacctcaagcatctccggtca
gtgtccttggaggacgcaacaagctttgcagagagggagggcctatccttcgtcgagacc
tcggcgctcgacgcgacgaatgtggataaagcttttcagacagtgctcactgagatctac
cggatcatcagcaagaaggcattggctgcagatgaggctggagctggtgctggtgctgtc
agagagggccaatctatccaagtctccgcgacagattccagcagttttacatcaagatgt
tgctctttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337555
Entry
4337555           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABA2a
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4337555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337555
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337555
   04031 GTP-binding proteins [BR:osa04031]
    4337555
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4337555
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4337555
  Exosomal proteins of colorectal cancer cells
   4337555
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4337555
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU DLIC AAA_22 FeoB_N PduV-EutP AAA_16 ABC_tran Gtr1_RagA MCM AAA_14 TniB AAA_24 AAA_5
Other DBs
NCBI-GeneID: 4337555
NCBI-ProteinID: XP_015639165
UniProt: Q0DLF1 Q75M17
LinkDB
Position
5:284962..287238
AA seq 220 aa
MAGTRRAEEEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLHVEG
KIIKAQIWDTAGQERYRAITSAYYRGALGAVLVYDVSKPTTFDNISRWLKELRDHADANI
RIMLVGNKTDLKHLRAVATDDAHKFAEAEGLSYIETSALEATNVEEAFQLILGDIYRAIS
KKPVASDEGGAGAAGGVKEGKTINVAAGDANSEKKQCCST
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcggggacgcggcgtgcggaggaggagtacgactacctgttcaaggtggttctcatc
ggcgactccggcgtcggcaagtccaacctcctctcccgtttcacccgcaacgagttctgc
ctcgagtccaagtccaccatcggcgtcgagttcgccacccgcaccctccatgtggagggc
aagataatcaaggcgcagatctgggacaccgcaggtcaagagcgatacagagctatcacc
agcgcttactaccgtggagctctaggagcagtcctggtctacgacgtgagcaagcccaca
acctttgacaacatcagccggtggctcaaggagctccgcgaccacgctgatgcaaacatc
agaatcatgctcgtcggcaacaagactgatctgaagcaccttcgggccgtcgcgacagac
gatgcgcacaagtttgctgaggcagaagggctgtcctacattgagacttcagctcttgag
gccacaaatgtggaggaggcattccagctgattctcggtgacatttacagggccatcagc
aagaagcccgtggcatcagatgaaggcggggcaggtgccgctggaggtgtcaaagaaggg
aagacgatcaatgtcgctgccggtgatgccaatagtgaaaagaagcaatgctgctcaact
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338288
Entry
4338288           CDS       T01015                                 
Name
(RefSeq) ras-related protein RGP2
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4338288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4338288
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4338288
   04031 GTP-binding proteins [BR:osa04031]
    4338288
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4338288
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4338288
  Exosomal proteins of colorectal cancer cells
   4338288
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4338288
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU TniB AAA_22 AAA_16 FeoB_N AAA_14 ABC_tran NTPase_1 AAA_21
Other DBs
NCBI-GeneID: 4338288
NCBI-ProteinID: XP_015637295
UniProt: Q40723 Q0DJH2
LinkDB
Position
5:complement(11723582..11725778)
AA seq 217 aa
MGGRVDHEYSYLFKMVLIGDSGVGKSNILSRFTRNHFSLDSKSTIGVEFATKSLQMEGKT
IKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQSFDNVHRWLRELRDHADSSIVI
MMVGNKSDLIHLRAVSEDEGKALAEKEGLFFLETSAMEAVNVEEAFQTIITEVYGIVNRK
ALAAKEAAAASAPLPSQGKTISIDSAAGNTKRACCSA
NT seq 654 nt   +upstreamnt  +downstreamnt
atgggcgggcgggtggatcacgagtactcgtacctgttcaagatggtgctgatcggcgac
agcggcgtcggcaagtctaatatcctctcccgcttcacccgcaaccacttctccctcgac
tccaagtccaccatcggcgtcgagttcgccaccaaatccctgcagatggagggcaaaaca
ataaaggctcagatctgggacacagcaggacaggagagatatcgtgccatcacaagtgct
tactaccgtggcgctgttggggctctccttgtttacgacatcacaaagaggcagagcttc
gacaatgtccacaggtggcttcgtgagctccgcgaccatgccgactcgagcattgttatc
atgatggtcggtaataagtctgatttgattcatctaagggctgtctccgaggatgaaggt
aaggcattggctgaaaaggaggggctgttttttcttgagacatcagctatggaggccgtg
aatgtggaggaagcctttcagactatcatcacagaggtctatggcattgttaacaggaaa
gcactggccgccaaagaagcagctgctgcttctgctccgctgccttcccagggtaaaact
atcagcattgacagcgctgcaggaaacacaaagagggcatgctgctctgcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339324
Entry
4339324           CDS       T01015                                 
Name
(RefSeq) ras-related protein RIC2-like
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339324
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339324
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339324
   04031 GTP-binding proteins [BR:osa04031]
    4339324
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4339324
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4339324
  Exosomal proteins of colorectal cancer cells
   4339324
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4339324
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_16 SRPRB PduV-EutP GTP_EFTU KAP_NTPase Gtr1_RagA AAA_24 AAA_22 ABC_tran MCM TniB AAA_21
Other DBs
NCBI-GeneID: 4339324
NCBI-ProteinID: XP_015637647
UniProt: B9FGS7 Q75II9
LinkDB
Position
5:complement(25625140..25627259)
AA seq 220 aa
MSAAAGGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLQ
VDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFDNVGRWLRELRDHTD
PSIVCMLIGNKSDLRHLVAVSTEDGKEFAEAESMYFMETSALDATNVDNAFAEVLTQIYQ
IVNKKPVEAPEDGSAGPGKGEKINVKDDVSAMKRVGCCSN
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtcggccgcggcgggcgggtacagggcggaggacgactacgactacctgttcaaggtg
gtgctcatcggcgactccggcgtcggcaagtccaacctcctctcccgcttcaccaagaac
gagttcagcctcgagtccaagtccaccatcggcgtcgagttcgccacccgcagcctccag
gtcgacggcaaggtcatcaaggcccagatttgggacaccgccggccaggagaggtatcgt
gctatcactagtgcctattaccggggagctgtgggagcattgctcgtctacgatgtcacc
cgtcgtgctacattcgacaacgtgggacgctggctaagggagcttagagaccacactgat
cctagcattgtctgcatgctgattggcaacaaatccgatctccgccacttggtggctgtc
tcaaccgaggacggcaaagagtttgctgaagccgaatcaatgtacttcatggaaacttct
gcgctcgacgctaccaacgtcgacaatgcgttcgcggaggtcctgactcagatataccag
attgtgaacaagaagccggtggaggcacctgaggatgggtcggctggcccaggaaaagga
gagaagataaacgtgaaagatgatgtctcggcgatgaagagagttggatgttgctcaaac
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339623
Entry
4339623           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABA1f
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339623
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339623
   04031 GTP-binding proteins [BR:osa04031]
    4339623
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4339623
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4339623
  Exosomal proteins of colorectal cancer cells
   4339623
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4339623
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU Gtr1_RagA AAA_22 AAA_16 ABC_tran DLIC SRPRB AAA_24 TniB FAD-SLDH FeoB_N DUF3234 AAA_21 PduV-EutP
Other DBs
NCBI-GeneID: 4339623
NCBI-ProteinID: XP_015639848
UniProt: Q6AUF8 Q0DFX6
LinkDB
Position
5:complement(28092831..28094581)
AA seq 217 aa
MAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKV
VKAQIWDTAGQERYRAITSAYYRGAVGALVVYDVTRHVTFENVERWMRELKDHTDANIVI
MLVGNKADLRHLRAVSTEDAKAFAEKENTFFMETSALESMNVENAFTEVLTQIYHVVSKK
ALDIGDDPAAPPKGQTINVGGKDDVSAVKKSACCSSA
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgtaccgggcggacgacgactacgactacctcttcaaggtggtgctcatcggggac
tccggggtcgggaagtcgaacctgctgtcccgcttcacgcgcaacgagttcagcctcgag
tccaagtccaccatcggcgtcgagttcgccacccgcagcatccacgtcgacgacaaggtc
gtcaaggcccagatctgggacaccgccgggcaagaaagatatcgagctattacaagcgca
tactatcgcggagcagtaggggcactcgttgtctatgatgtcacgcgacatgtcaccttt
gagaatgtggagaggtggatgagggagctcaaggatcacacggacgccaacatcgtgatc
atgcttgtggggaacaaggcagatttgcgccaccttagggctgtctcgactgaggatgcg
aaagcatttgctgagaaagagaacactttcttcatggagacgtcggccctggagtcaatg
aatgtggagaatgccttcactgaagtgctcacccagatatatcatgtagtgagcaagaag
gctcttgacatcggcgatgacccagctgcaccaccaaaggggcagaccatcaatgttggt
ggcaaagatgatgtctctgcagtgaaaaagtctgcttgttgttcatcagcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341266
Entry
4341266           CDS       T01015                                 
Name
(RefSeq) ras-related protein RIC2
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341266
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341266
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341266
   04031 GTP-binding proteins [BR:osa04031]
    4341266
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4341266
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4341266
  Exosomal proteins of colorectal cancer cells
   4341266
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4341266
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_16 GTP_EFTU Gtr1_RagA AAA_22 AAA_14 ABC_tran SRPRB KAP_NTPase PduV-EutP AAA_24 TniB MCM AAA_21
Other DBs
NCBI-GeneID: 4341266
NCBI-ProteinID: XP_015644018
UniProt: P40393
LinkDB
Position
6:complement(20896081..20901758)
AA seq 217 aa
MAAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDG
KVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNI
VVMLVGNKSDLRHLVAVQTDEGKAFAERESLYFMETSALESTNVENAFAEVLTQIYRIVS
KRSVEAGDDAGSGPGKGEKINIKDDVSAVKKGGCCSG
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcggcggggtaccgggcggaggacgactacgactacctcttcaaggtggtcctcatc
ggcgactccggcgtcggcaagtccaacctcctctcccgcttcacccgcaacgagttcagc
ctcgagtccaagtccaccatcggcgtcgagttcgccacccgctccctccaggtcgacggc
aaggtcgtcaaggcccagatttgggacaccgccggccaggagcgataccgtgctattact
agtgcatattaccgaggtgctgttggagcgttgcttgtctatgatgtcacccggcactca
acctttgagaatgttgagcgctggttgaaggaattgagggaccatacagacccaaacata
gttgtcatgctagttggcaacaagtctgatctgcgccatcttgtagcggttcaaaccgat
gaagggaaggcattcgcggagagagaatcgctctatttcatggagacctctgcgctcgag
tccaccaacgttgagaatgcatttgcagaggtcttgacccagatctaccgcatcgtgagc
aagaggtcagtcgaagcaggtgatgatgcaggttctggtcctggcaagggtgagaagatc
aatataaaggatgatgtttcggcggtgaagaagggcggctgctgctcgggctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342063
Entry
4342063           CDS       T01015                                 
Name
(RefSeq) ras-related protein RABA3
  KO
K07904  Ras-related protein Rab-11A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4342063
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4342063
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4342063
   04031 GTP-binding proteins [BR:osa04031]
    4342063
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    4342063
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4342063
  Exosomal proteins of colorectal cancer cells
   4342063
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    4342063
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 SRPRB GTP_EFTU PduV-EutP TniB
Other DBs
NCBI-GeneID: 4342063
NCBI-ProteinID: XP_015642685
UniProt: A0A0P0X151
LinkDB
Position
6:complement(30335712..30337937)
AA seq 225 aa
MEEEDYVFKVVVIGDSAVGKTQLLGRFTKDEFFIDSKSTIGIEFQTRTVEIGGKRVKAQI
WDTAGQERYRAVTSAYYRGALGAMLVYDVTSRRSFHHAARWLHDLRAHADNSIVVMLIGN
KADLSHARAVAADEAAAFAEDQGLFFSEASALSGDNVEEAFLGLLREIHAIVSRRSLLEM
DGINGDAAANANAALMLRGTKLSLSDELSIMETSAIKRVSRCSCS
NT seq 678 nt   +upstreamnt  +downstreamnt
atggaggaggaggattatgtgttcaaggtggtggtgatcggggactcggcggtggggaag
acgcagctgctggggcggttcacaaaggacgagttcttcatcgactccaagtcgaccatc
ggcatcgagttccagacgcggacggtggagatcggcgggaagcgggtgaaggcccagatc
tgggacaccgcggggcaggagaggtaccgcgccgtcaccagcgcctactaccgcggcgcc
ctcggcgccatgctcgtctacgacgtcaccagccgccggagcttccaccacgccgcccgc
tggctccacgacctccgcgcccacgccgacaactccatcgtcgtcatgctcatcggcaac
aaggccgacctctcccacgcccgcgccgtcgccgccgacgaggccgccgccttcgccgag
gaccagggcctcttcttctccgaggcgtcggcgctcagcggggacaacgtcgaggaggcc
ttcctcggcctcctccgggagatccatgccatcgtctcgcggaggtcgctgctggagatg
gacggcatcaacggcgacgccgccgccaacgccaacgccgcgctcatgctcaggggcacc
aagctctcgctctccgacgagctctccatcatggagaccagcgccatcaagagagtgagc
aggtgctcatgctcttaa

DBGET integrated database retrieval system