KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324637
Entry
4324637           CDS       T01015                                 
Name
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase-like protein 5
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4324637
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4324637
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4324637
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     4324637
SSDB
Motif
Pfam: ECH_2 ECH_1 RRM_1
Other DBs
NCBI-GeneID: 4324637
NCBI-ProteinID: XP_015621798
UniProt: Q5JMX9 Q5JN53
LinkDB
Position
1:complement(31552901..31556871)
AA seq 389 aa
MAEPEQQQQQANPDEVVLGQETGGARVAILNRPRQLNVISDRVVYLLAQFLESWEKDEDA
KLVIFKGAGRAFSAGGDLKMFYEGKSDDSCLEVVYRMYWLCYHIHTYKKTAVALVNGLVM
GGGAAMVAPLKFAVVTEKTVFATPEASVGLHTDCSFSYIHSRLPGYLGEYLALTGARLNA
KEMIAAGLATHFVPSEKLEELEKCLLNLNTGDESAVRAAIEEFSTDVQPDEDSILNKLPT
INKCFSAETIEDIIKAFESEGSIDGNQWIATVLKGMRRSSPTSLKMTLRSIREGRKQSLP
ECLKKEFRLTMNTLRSVVTGDVYEGIRALSIDKDNAPKWSPATLEEVKNEDIDRLFEPFS
SEKELQVPSDDSNRWSGKFEHTVYGRTSE
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggagccggagcagcagcagcagcaggcgaatcccgacgaggtggtgctcgggcag
gagaccggcggcgcgagggtggcgatcctcaaccggccgcgccagctgaacgtcatctcc
gatagagtggtgtatctcctcgcccagttcttggagagctgggagaaagatgaggatgcc
aagctggtcatcttcaagggggctggacgtgcattttccgctggtggggatctaaagatg
ttctatgaaggaaaatcagatgactcctgtctcgaggttgtttacaggatgtattggctt
tgctaccatatccacacgtataagaaaaccgcggtggctcttgttaatggacttgtcatg
ggtggtggtgcagccatggttgctccactgaagtttgcagttgtcacagagaaaacagtc
ttcgcaacccctgaggctagtgttggattacacacagactgcagcttttcttatatccat
tctagactccctggatatttaggggagtacctggctttgaccggtgcaaggttgaatgca
aaggaaatgattgctgccggtcttgctactcattttgttccttctgaaaaattggaagaa
cttgaaaaatgcctgctgaatttaaacacaggagatgagtctgctgttcgagctgctatt
gaagagttctcaactgatgttcaacctgatgaagatagtattttaaacaagctcccaact
atcaacaaatgtttctctgctgagactatcgaggacatcataaaagcttttgaatcagaa
gggagcattgatggaaaccaatggatcgctacagtactgaagggcatgcgaagatcatct
cctacttcactgaagatgactcttcgatcgatcagagaaggtcggaagcagagcctgccg
gaatgtttgaagaaggaattccgacttacaatgaacactctccgatctgtagttactggc
gatgtctatgagggaattagagctctcagcatcgacaaagacaatgcccctaagtggagt
cctgctacccttgaggaggtcaagaacgaggacatcgaccgtcttttcgaaccattcagt
tcagaaaaggagctccaagtcccatctgacgattccaacagatggagtggcaaatttgag
cacacagtctatggcagaacttcagagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341424
Entry
4341424           CDS       T01015                                 
Name
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial isoform X1
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4341424
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4341424
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4341424
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     4341424
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-GeneID: 4341424
NCBI-ProteinID: XP_015643955
UniProt: Q69UF2 Q0DB81
LinkDB
Position
6:23343917..23350822
AA seq 434 aa
MGCSHVTMRALLSRIHPPGPGSISTTSFLQCPSSTAASASKTLAPTLTFRRFAAMAAAAA
EEFVKGRVTPNGVAVITLDRPKALNAMNLEMDLRYKAFLDEWETNPSVKCVLVESSSPRA
FSAGMDIKGVAAEIQKDKSTPLVQKVFTAEYSLICKIHEYTKPYICLMDGVTMGFGIGLS
GHGRYRIITERTLLAMPENGIGLFPDVGFAYIGAKAPGGGAVGSYLGMTGKRISSPADAL
FFGLGTHYVPSANLGPLRESLLSANFTDDPHRDVESLLTKFKNEPESGPQLDKFLPYIIS
SFGPDKSVAESVEELKKCSQSDDAAVAEWANEALAGLKKGAPFSLCLTQKHFSQVASAYR
NNEHYLSKLAGVMKVEYRIALRSSVRNDFVEGVRAVLVDKDQNPKWKPATLEDVDKGEVE
SVFEPLAAEAELNV
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgggttgctctcacgtcactatgcgagctctcctctcccgcatccacccgcccggcccc
ggatcgatctccaccacttccttcctccagtgcccctcctccaccgccgcatccgcctcc
aaaaccctagccccgaccctcaccttccgccgcttcgccgccatggccgccgccgccgcg
gaggagttcgtgaagggccgcgtcacccccaacggcgtcgccgtcatcaccctcgaccgc
cccaaggccctcaacgccatgaacctcgaaatggaccttcgatacaaggcatttcttgat
gaatgggaaacaaatccaagtgtcaagtgtgttcttgtggaaagcagttcaccccgtgcc
ttctcagctgggatggatattaagggtgttgcagcagaaattcaaaaggacaagagcaca
ccacttgtgcaaaaggtcttcacagcagagtactctttgatttgtaagattcatgagtat
acaaaaccttatatatgcctgatggatggtgtgacaatgggatttggaattggattatca
gggcatggccgctaccgcattattactgagaggacgctcctggctatgccagaaaatggt
attggcttgttcccggacgttggctttgcttacattggtgccaaagctccaggaggtggt
gctgttggatcttaccttgggatgacagggaaaaggatatcatcacctgctgatgccctt
ttctttggtcttggaactcattatgtaccttcagcgaacctgggacctctcagggaatcc
ctcttgagtgctaacttcacagatgatcctcacagagatgttgagtcattgctgacaaag
ttcaagaacgagccagagtcagggccccagctagataagtttttaccatatatcatttct
tcctttggtcctgacaaatcagttgctgaatctgtggaagagcttaagaagtgtagtcaa
agtgatgatgctgcagtggcagaatgggccaacgaggccttggcaggactcaaaaaaggg
gctccattttctctatgtttaactcaaaaacatttttctcaagttgcatcagcatatagg
aataatgaacactatctatcgaagttggctggtgttatgaaagttgaatatcgaattgcc
ttgaggtcatcggttcgaaatgattttgttgaaggtgtacgtgctgtcttagttgacaag
gaccagaatccaaagtggaagccagcaactctggaagacgtggacaagggtgaggtggaa
tcagtttttgaaccattagctgctgaggctgagttaaatgtatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349332
Entry
4349332           CDS       T01015                                 
Name
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4349332
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4349332
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4349332
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     4349332
SSDB
Motif
Pfam: ECH_2 ECH_1 RskA
Other DBs
NCBI-GeneID: 4349332
NCBI-ProteinID: XP_015612965
UniProt: A0A8J8Y805 Q336U0
LinkDB
Position
10:complement(21700751..21704809)
AA seq 411 aa
MPTLAAAAAAARRAGGALRYAVLGGVRSLSSLQPSSSSSAAAAASEEVLVEGKASARAAV
LNRPGHLNALTTTMGARLNKFYMSWEDNPDIGFVMMKGSGRAFCAGGDVVRLHQLISEGK
LDECKDFFKTLYSFIYVLGTYLKPHVAILDGVTMGGGGGVSIPGTFRIVTDRTVFATPEV
HIGFHPDAAASFYLSHLTGHVGEYLALTGEKLNGVDMIALGLATHYSMSDRLNLVDERLA
TLLTDDPSVIDTSLTHYGDLVYPDKSSIVHRLEVIDKCFSLETVEEIVDAMEIEAARLNE
DWSTLALKRLKEASPLALKVSLRSIREGRYQTLDECLVREYRMSINGISEKFSHEFREGV
RARLVEKDLAPKWDPPALEYVSADMVDSYFAPLGEFEPELTLPTESREAFV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccgaccctcgccgccgccgccgccgccgcccgccgcgccggcggggcactgcgatac
gccgtgctgggcggggttcggtcgctctcatccctccagccgtcatcctcctcctccgcc
gcagccgccgccagcgaggaggtgctggtggaaggcaaggccagcgcgcgcgccgccgtg
ctcaaccgccccggccatctcaacgcgctcacgaccaccatgggagctaggctcaataag
ttttatatgtcatgggaggacaaccctgatattggctttgtcatgatgaagggcagcggc
cgagcattctgtgctggtggggatgttgttaggttgcaccagcttataagtgaaggaaag
ttggacgagtgtaaggatttcttcaagactttgtacagttttatttatgttctgggcaca
tacttgaagccacatgttgccattcttgatggtgttaccatgggtggaggtggaggtgtt
tccattcccggaacatttcgcattgtcactgatagaacggtatttgcaactccagaagta
catattggcttccatcctgatgctgctgcctccttttatttgtcccatctgactggtcat
gttggtgaatatttggccttgactggtgaaaaactcaatggagtggatatgatcgcactt
ggccttgctacacactattccatgagtgatcggttgaatctggttgatgaacgccttgca
acattgttaactgatgatccatcagttattgatacttcccttacacattatggagatctt
gtgtatccagataagagtagcattgttcataggctggaggttatagataaatgtttcagc
cttgaaacagtcgaggagattgtggatgccatggaaattgaagcagctaggttaaatgaa
gattggtctaccttggccctgaaacggttgaaagaggcttctcctcttgcgttgaaagtt
tcactgcgatcgatacgtgaaggtagataccagacacttgatgaatgccttgtgcgtgaa
taccgcatgtctatcaatggaatctcagagaaattttctcatgaatttcgtgagggtgtc
agagcacgtcttgtggagaaggacctagctccaaagtgggatccacctgcccttgagtat
gtatcagcggacatggtcgattcttactttgctcccctgggtgaatttgagcctgagttg
acactgcctactgaatcgcgagaggcatttgtatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351929
Entry
4351929           CDS       T01015                                 
Name
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4351929
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4351929
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4351929
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     4351929
SSDB
Motif
Pfam: ECH_2 ECH_1 KH_1 SLS CENP_C_N
Other DBs
NCBI-GeneID: 4351929
NCBI-ProteinID: XP_015619693
LinkDB
Position
12:9350844..9365580
AA seq 621 aa
MSSFTTIKFDSKFFIGLKKVGPNCKGPPLPFLSLLLFLFLSLSYLLCSLLPFLRDSPRQR
GRGGHGARRGGGLARRGAGLARRARRPAPSPSQIQRRRAGQGPVVAGSGAARRERRGSGL
GSPAAPTTTMGGADLVAATATTRTRTAVEASSDVDSDNEDGVAGGVLQSNESSAKVDEPV
ATENSDAAPAEASVDAVNGKIPPTKLIPQHPLEGVTLTERTVRITGNKKQIEAAKDIIKQ
AMSQVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAF
CAGGDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIH
GRFRVVTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLA
THFVPSDVVHSLLQRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIIN
KCFSKKTVEEIIASLEQEAPNVADEWIASAIQSMRKASPTSMKISLRSIREGRTQTVGEC
LRREYRMVCHVMRGDFSRDFFEGCRAILLDRDRNPKWMPPRLEEVHDEVVEKYFSKVDDP
EWEDLDLPPRRSHGRRLVPKL
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgagttcatttactacgataaaattcgattcaaagtttttcattggattaaagaaggtg
ggtcccaactgtaagggtcctcctcttccttttctttcccttcttctcttcctctttctc
tctctttcttatctcctctgctctcttctcccctttcttcgcgattctccacgccagagg
gggaggggcgggcatggcgcgcggcggggtggcggcctagcacggcggggtgccggcctg
gcgcggcgggcgagacggccggcgccctccccctcccaaatccagcggcggcgggctggg
caggggccggtcgtggccgggagcggcgcggcgcggcgtgagcggcgtggcagcggcttg
ggatctccggcggctccgacaacaacgatgggaggggcagatctggtggcggcgacggcg
acgacgaggacaaggacggctgtggaggcttcgagcgacgtcgatagcgacaacgaggat
ggcgtcgccggcggtgtcttgcagagcaacgagtcctccgcgaaggtcgatgagccggta
gctacagagaacagtgacgctgctcctgctgaggcatctgtagatgctgtgaacggcaag
attcctcctaccaagttgattccccaacatcctctggaaggtgttacattgacagaaaga
actgtacgtattactgggaataagaagcagatagaagcggcaaaagatattattaagcaa
gctatgagtcaggttttggtagaagcaaatggtgtaacacggacattggttttgaatagg
ccaaagcagttgaatgccctctcctctgcaatgataacgtgttttttgaggtgcttcact
gcttatgaggaagatgatggagttaaactattgattgtgaagggaaaaggaagagcattt
tgtgcaggtggagatgttgctgcagttgtccggtctataaataatgatagctggaaatat
ggtgctcattttttccgaaatgaatttctgttaaactatatcattgcaacatatagcaaa
cctcaggtttcgcttctaactggaattgtcatgggtggaggtgctggtgtttctatacat
ggaaggttccgagttgtcacagatagcacggtttttgctatgccagaaacagcgttgggt
ctctttccagatattggggcttcatattttctatctcgacttcttgggttctatggagag
tatgttggtcttactggtgtaaggttggatgctgctgaaatgcttgcttgtggcctagca
actcattttgtaccttcagatgtagtacactcactcttgcagaggctgtctttgctagaa
gaatcacttaaaaaggttgatacatctgatccatttgctatatgtggaattatcgatcaa
tattcgcaacaaccatctctgaaagaaaaaagcgctctgaataggctagaaatcatcaac
aaatgcttttccaaaaaaacagtagaagaaatcatagcctctcttgaacaagaggctcca
aatgttgctgatgaatggattgcttctgcaatccagtccatgaggaaggcttctcctact
agtatgaaaatatccttgagatcgataagagaagggcgaacacaaactgttggtgaatgc
ttacgtcgagaatatagaatggtttgccatgtgatgcgtggtgacttcagtagagacttc
tttgagggatgcagggctatattgttggatagagatcgaaacccaaagtggatgcctcca
aggttggaagaggtgcacgacgaggtggtcgaaaaatatttttccaaagtcgatgatcca
gagtgggaagatttggacctacctcctagacgttcccatggaaggaggcttgttcccaag
ctttga

DBGET integrated database retrieval system