KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324641
Entry
4324641           CDS       T01015                                 
Name
(RefSeq) endoglucanase 1
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324641
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4324641
SSDB
Motif
Pfam: Glyco_hydro_9 CBM49
Other DBs
NCBI-GeneID: 4324641
NCBI-ProteinID: XP_015642063
UniProt: Q5NAT8
LinkDB
Position
1:complement(6541828..6544546)
AA seq 640 aa
MARRGGAAASSSMANLLGVALVLAATAQTSARGGGGGGRHDYRMALSKSILYFEAQRSGV
LPGNQRIAWRANSGLADGKANGVDLVGGYYDAGDNVKFGFPMAFTVTMMAWSVLEYGKQM
AAAGELGHAMDAVRWGADYFVKAHPAPNVLYGEVGDGDSDHVCWQRPEDMTTSRQAYRLD
PQHPGSDLAGETATALAAASLVFRSSNPGYANQLLQHSKQLFDFADKYRGKYDDSMPVVK
KFYGSFSGYGDELLWASAWLYQATDNRRYLDYLANNGDALGGTGWATNEFGWDVKYPGVQ
VLAAKFLLQGKAGPHAAVLRRYQRNADVFACSCLGKGGGGGNVGRTPGGLMYHQGWNNLQ
FVTGASFLLAVYADHLAAAGRGQAVVRCQAGPAARASELVALAKSQVDYILGSNPRGISY
MVGYGARYPRRAHHRGASIVSIRANPSFVSCKDGYASWFGRAGSNPNLLDGAVVGGPDGR
DGFADERNNYQQTEVATYNNAPLMGVLARLAGGGRGGLAEAAIKRPDNQTLLPPLAAAAS
PVEITQLNATASWKKDGRTYRRYAATVSNRSPAGGKTVEELHIGIGKPHGPVWGLEKAAR
YGYVLPSSLAAGESAAFAYVVRGRAAPPPADVWVIGYKLV
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggccaggagaggaggagcagcagcatcgtcgtccatggctaatctcctcggcgtcgcc
ttggtgctcgccgccacggcgcagacgtcggcgcgtggcggcggcggcggcggacgccat
gactaccgcatggcgctgagcaagagcatcctctacttcgaggcgcagcgctccggcgtg
ctccccggtaaccagaggatcgcatggagggccaactccggcctcgccgacggcaaggcc
aacggcgtggatcttgttggtggctactacgacgccggagacaacgtcaagttcgggttc
ccgatggcgttcacggtgaccatgatggcgtggagcgtcctcgagtacgggaagcagatg
gcggccgccggcgagctcggccacgccatggacgccgtcaggtggggcgccgactacttc
gtcaaggcgcacccggcgcccaacgtgctctacggcgaggttggagatggtgactcggac
cacgtctgctggcagcggccggaggacatgacgacgagccgtcaggcgtatcgccttgac
cctcagcatcctggctctgacctcgccggagaaaccgccacggcattggccgccgcgtcg
ctcgtcttccgtagctccaacccgggctacgcaaaccaactcctgcaacactccaagcag
ctgtttgatttcgccgacaagtaccggggaaagtacgacgacagcatgcctgtcgtgaag
aaattttacgggtcattcagcggatacggggatgaactactgtgggcatcggcatggcta
taccaggcgaccgacaaccgccgctacctagattacttggccaacaatggtgacgcactc
ggcgggaccggttgggctaccaacgaattcggctgggacgtcaagtaccccggagtgcaa
gtcctagctgcaaagtttctcctgcaagggaaggccgggccgcacgccgccgtgctgcgg
aggtaccagcggaacgccgacgtcttcgcgtgctcctgcctcggcaagggcggcggcggt
ggcaacgtcgggaggacgcccggcggcctgatgtaccaccagggctggaacaacctccag
ttcgtcaccggcgcgtcgttcctgctggccgtctacgccgaccacctcgccgccgccggc
cgcgggcaagccgtcgtgcggtgccaggccgggccggcggcgcgggcgtcggagctcgtc
gcgctggccaagtcgcaggtggactacatcctgggtagcaacccgagggggattagctac
atggtcggctatggcgcgaggtacccgcggcgcgcgcaccaccgcggcgcgtccatcgtc
tccatcagggccaacccgtcgttcgtgagctgcaaggatgggtacgcgagctggttcggc
cgcgccggcagcaacccgaacctgctcgacggcgccgtggtcggcggccccgacgggcgc
gacggcttcgccgacgagaggaacaactaccagcagacggaggtggccacctacaacaac
gcgccgctcatgggcgtcctcgctcgcctcgccggcggcggccgcggcgggctcgccgaa
gcagcgatcaagaggccggacaaccagaccttgctgccacctctcgcagctgcggcgtcg
ccggtggagatcacgcagctgaacgcgacggcgtcgtggaagaaggacgggaggacgtac
cgccggtacgcggcgacggtgagcaacaggtcgccggccggcggcaagacggtcgaggag
ctccacatcggcatcggcaagccgcacggcccggtgtgggggctcgagaaggcggcgagg
tacggctacgtgctcccgtcgtcgctggccgccggcgagagcgccgccttcgcctacgtt
gtccgcggccgcgccgcgccgccgccggctgacgtctgggtcatcggctacaagctcgtc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324643
Entry
4324643           CDS       T01015                                 
Name
(RefSeq) endoglucanase 2
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4324643
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4324643
SSDB
Motif
Pfam: Glyco_hydro_9 CBM49
Other DBs
NCBI-GeneID: 4324643
NCBI-ProteinID: XP_015621149
UniProt: Q5NAT0
LinkDB
Position
1:complement(6564670..6568160)
AA seq 640 aa
MARGGGAAGVSMAHHLGIALVVLVFAAMAQVARGGGGGHDYGMALSKSILYFEAQRSGVL
PGSQRIAWRANSGLADGKANGVDLVGGYYDAGDNVKFGLPMAFTVTMMAWSVIEYGEEMA
AAGELGHAVEAIKWGTDYFAKAHPEPNVLYAEVGDGDSDHNCWQRPEDMTTSRQAYRLDP
QNPGSDLAGETAAAMAAASLVFRSSNPGYADQLLQHSKQLFDFADKYRGRYDNSITVARN
YYGSFSGYGDELLWASAWLYQASDDRRYLDYLANNADALGGTGWSINQFGWDVKYPGVQI
LAAKFLLQGKAGEHAGVLQGYRRKADFFACSCLGKDAADNVGRTPGGMLYHQRWNNIQFV
TSASFLLAVYSDHLAGGAVRCSGGGGAVAGAAELLAFAKSQVDYILGSNPRGTSYMVGYG
AVYPRQAHHRGSSIASIRASPSFVSCREGYASWYGRRGGNPNLLDGAVVGGPDEHDDFAD
ERNNYEQTEAATYNNAPLMGILARLAAGHGARARGRLGQSLQHGIAANHTSLPHGANHQH
ASPVEIEQKATASWEKDGRTYHRYAVTVSNRSPAGGKTVEELHIGIGKLYGPVWGLEKAA
RYGYVLPSWTPSLPAGESAAFVYVHAAPPADVWVTGYKLV
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggctaggggaggaggagcagctggtgtgtccatggctcatcacctcggcattgccttg
gtggtgcttgtctttgccgccatggcgcaggtggcgcgcggcggcggcggcggccatgac
tatggcatggcgctgagcaagagcatcctctacttcgaggcgcagcgctccggcgtgctc
ccgggtagccagaggatcgcatggagggccaactccggcctcgccgacggcaaggccaac
ggcgtggatcttgttggtgggtactacgacgccggcgacaacgtcaagttcgggctgccg
atggcgttcacggtgaccatgatggcgtggagcgtcatcgagtacggcgaggagatggcg
gcggccggcgagctcggccacgccgtggaggccatcaagtggggcaccgactacttcgcc
aaggcgcacccggagcccaacgtgctctacgctgaggtcggcgatggtgactccgaccac
aactgctggcagcggccggaggacatgacgacaagccgtcaggcgtaccgccttgatcct
cagaatcccggctctgacctcgccggagaaaccgccgcggccatggcggctgcgtcactc
gtcttccgtagctccaacccgggctacgcagaccaactcctgcaacactctaaacagctg
tttgatttcgccgacaagtaccggggaaggtacgacaacagcatcaccgtcgcgaggaac
tattacgggtcattcagcggatacggggatgagctactgtgggcgtcggcgtggctatac
caagcgagcgacgaccgccgctacctcgactacttggccaacaacgcggatgcgctaggc
gggacgggctggtccatcaaccagtttgggtgggacgtcaagtaccccggagttcaaatc
ctagctgcaaagtttctcctccaaggcaaagccggcgagcacgccggcgtcctgcaggga
taccggcggaaggcggacttcttcgcgtgctcgtgcctcgggaaggacgccgccgacaac
gtcgggaggacgcccggcggaatgctgtaccaccagaggtggaacaacatccagttcgtc
accagcgcgtcgttcctcctcgccgtctactccgaccacctcgccggcggcgccgtgagg
tgctcgggcggcggcggggcggtggccggggcggcggagctcctggcgttcgccaagtcg
caggtggactacatcctggggagcaacccgagggggacgagctacatggtcggctatggc
gccgtctacccgcggcaggcgcaccaccgcggctcgtccatcgcctccatcagggccagc
ccgtcgttcgtgagctgcagggaggggtacgcgagctggtacgggcggcggggcggcaac
cccaacctgctcgacggcgccgtcgtcggcggccccgacgagcacgacgacttcgccgac
gagaggaacaactacgagcagacggaggcggccacctacaacaacgccccgctcatgggc
atcctcgcccgtctcgccgccggccatggcgcccgcgcccgcggccggcttggccagtca
cttcaacacggaatcgctgcaaatcacacttcactgcctcatggtgccaatcaccagcat
gcgtcgccggtggagatcgagcagaaggcgacggcgtcgtgggagaaggacgggaggacg
taccaccggtacgcggtgacggtgagcaacaggtcgccggcgggcggcaagacggtggag
gagctccacatcggcatcggcaagctgtacggcccggtgtgggggctcgagaaggcggcg
aggtacggctacgtgctcccgagctggaccccgtcgctgcccgccggcgagagcgccgcc
ttcgtctacgtccacgccgcgccgccggccgacgtctgggtcaccggctacaagctcgtc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327286
Entry
4327286           CDS       T01015                                 
Name
(RefSeq) endoglucanase 3
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4327286
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4327286
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4327286
NCBI-ProteinID: XP_015625766
UniProt: Q8LQ92
LinkDB
Position
1:11756856..11759568
AA seq 499 aa
MALLRCLFLLAVLLPHRNAAVVAAASPHHGPAPHDYRDALTKSILFFEGQRSGKLPPSQR
VSWRGDSGLSDGSSIKVDLVGGYYDAGDNMKFGFPLAFSMTMLAWSVVEFGGLMKGELQH
ARDAVRWGSDYLLKATAHPDTVYVQVGDANRDHACWERPEDMDTPRTVYKVDPSTPGTDV
AAETAAALAAASLVFRKSDPAYASRLVARAKRVFEFADKHRGTYSTRLSPYVCPYYCSYS
GYQDELLWGAAWLHRATKNPTYLSYIQMNGQVLGADEQDNTFGWDNKHAGARILIAKAFL
VQKVAALHEYKGHADSFICSMVPGTPTDQTQYTRGGLLFKLSDSNMQYVTSSSFLLLTYA
KYLAFSKTTVSCGGAAVTPARLRAIARQQVDYLLGSNPMGMSYMVGYGAKYPRRIHHRAS
SLPSVAAHPARIGCSQGFTALYSGVANPNVLVGAVVGGPNLQDQFPDQRSDHEHSEPATY
INAPLVGALAYLAHSYGQL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggctctcctccgctgcctcttcctcctcgccgtccttcttccccaccgcaatgccgcc
gtcgtcgccgccgcgtcgccgcaccacggccccgcgccgcacgactacagggacgcgctc
accaagtccatcctcttcttcgagggccagcgctccgggaagctgccgccgtcgcagcgc
gtctcctggcggggtgactccggcctctccgacggctcctccatcaaggtggacttggtg
ggagggtactacgacgccggcgacaacatgaagttcgggttcccgctggcgttcagcatg
acgatgctggcgtggagcgtggtggagttcggtggactcatgaagggtgagctccagcac
gccagggacgccgtccgctggggctccgactacctcctcaaggccaccgcccacccggac
accgtctacgtccaggtcggtgatgccaacagggaccacgcgtgctgggagcggccggag
gacatggacacaccgaggaccgtgtacaaggtcgacccgagcaccccgggcaccgacgtc
gcggccgagaccgccgcggcgctcgccgccgcctcgctcgtcttccgcaagtccgacccg
gcctacgccagccgcctcgtcgccagggccaagagggtgtttgagttcgcggacaagcac
aggggcacgtacagcacccgtctctcgccatacgtctgcccatactactgctcctactcc
gggtaccaggatgagctgctgtggggggcggcatggctacacagggcgaccaagaacccg
acgtacctgagctacatccagatgaacgggcaggtgctgggcgcggacgagcaggacaac
acgttcgggtgggacaacaagcacgccggggcgaggatcctgatcgccaaggcgttcctg
gtgcagaaggtggcggcgctgcacgagtacaagggccacgccgacagcttcatctgctcc
atggtgcccggcacccccacggaccagacgcagtacacccgcggcggcctcctcttcaag
ctcagcgacagcaacatgcagtacgtcacctccagctccttcctgctgctcacctacgcc
aagtacctcgccttctccaagaccaccgtctcctgcggcggcgccgccgtcacgccggcc
cgcctccgcgccatcgcgcgccagcaggtggactacctgctggggagcaacccgatgggg
atgtcgtacatggtcgggtacggcgccaagtacccgcggaggatccaccaccgcgcgtcg
tcgctgccgtcggtggcggcgcaccccgccaggatcggctgctcgcaggggttcaccgcg
ctctactccggcgtcgccaaccccaacgtcctcgtcggcgccgtcgtcggagggcccaac
ctgcaggaccagttccccgaccagcgcagcgaccacgagcactccgagccggccacctac
atcaacgcgccgctcgtcggagcgctcgcctacctcgcccactcctacggccagctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330637
Entry
4330637           CDS       T01015                                 
Name
(RefSeq) endoglucanase 6
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330637
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4330637
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4330637
NCBI-ProteinID: XP_015625116
UniProt: Q6Z2J3
LinkDB
Position
2:30573382..30577267
AA seq 508 aa
MLAASLRVEAVAVVAAAVLVLLLSPAAVVVVAGQHDYGDALHKSILFFEGQRSGRLPPDQ
RLRWRRDSGLHDGAAASVDLTGGYYDAGDNVKFGFPMAFTATLMSWGLIDFGRSFGPHKE
EARKAVRWATDYLMKATAKPNTVYVQVGDAFRDHSCWERPEDMDTPRTVYKVDPSHPGSD
VAAETAAALAAGSIVFRDADPAYSKRLLDRAIAVFEFADKYRGPYSSSLHDAVCPCYCDF
SGYKDELLWGAAWLHKASRRREYREYIKKNEVVLGASESINEFGWDNKHAGINVLISKEV
LMGKDEYFQSFRVNADNFMCSLLPGISNHPQIQYSPGGLLFKVGGSNMQHVTSLSFLLLA
YSNYLSHAGARVSCGAGGSASPTQLRRVAKRQVDYILGDNPLRMSYMVGYGARFPRRIHH
RGSSLPSVAAHPARIGCKGGAAYYASAAPNPNLLVGAVVGGPSDATDAFPDARAVFQQSE
PTTYINAPLMGLLAYFSAHPNPAEWADD
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgctggcggcgtcgttgagagtcgaggcggtggcggtggttgctgcggctgtgctggtg
ctgctgctctcgccggctgcggtggtggtggtggccgggcagcatgattacggcgacgcg
ctccataagagcatactgttctttgagggacagcgctccggcaggcttcctcccgaccag
cgtctccgctggcgccgcgactccggcctccacgacggcgccgccgccagcgtggacttg
accggagggtactacgacgccggcgacaacgtgaagttcgggttcccgatggcgttcacg
gcgacgctgatgtcgtgggggctgatcgacttcgggcggagcttcgggccgcacaaggag
gaggcgaggaaggcggtgcggtgggcgacggactacctgatgaaggcgacggcgaagccc
aacaccgtgtacgtgcaggtcggcgacgccttccgcgaccactcgtgctgggagcgcccc
gaggacatggacacgccccgcaccgtctacaaggtcgacccctcccaccccggctccgac
gtcgccgccgagaccgccgccgccctcgccgccggctccatcgtcttccgcgacgccgac
cccgcctactccaagcgcctcctcgaccgcgccatcgccgtgttcgagttcgcggacaag
taccggggcccctacagcagcagcctccacgacgcggtgtgcccctgctactgcgacttc
tccgggtacaaggacgagctgctctggggcgcggcgtggctgcacaaggcgtcgcgccgc
cgcgagtaccgcgagtacatcaagaagaacgaggtggtgctcggcgccagcgagtccatc
aacgagttcggctgggacaacaagcacgccggcatcaacgtcctcatctccaaggaggtt
ctgatggggaaggacgagtacttccagtcgttccgtgtcaacgccgacaacttcatgtgc
agcctcctcccgggcatctctaatcacccccagatccagtactccccaggtgggctgctg
ttcaaggttgggggcagcaacatgcagcacgtgacatcgctgtcgttcctgctgctcgcc
tactccaactacctgagccacgccggcgcgcgggtgtcgtgcggcgcgggcggctcggcg
tcgccgacgcagctccgccgcgtggccaagcgccaggtggactacatcctcggcgacaac
ccgctgcggatgtcgtacatggtgggctacggcgccaggttcccgcggcggatccaccac
cgcgggagctccctcccgtccgtcgccgcgcacccggcgcggatcgggtgcaagggcggc
gccgcctactacgccagcgcggcgcccaaccccaacctgctggtgggcgccgtcgtgggc
gggcccagcgacgccacggacgcgttccccgacgcgcgcgccgtgttccagcagtcggag
cccaccacgtacatcaacgcgccgctcatgggcctcctcgcctacttctccgcccaccca
aacccagccgagtgggccgacgactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330912
Entry
4330912           CDS       T01015                                 
Name
(RefSeq) endoglucanase 8
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330912
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4330912
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4330912
NCBI-ProteinID: XP_015624767
UniProt: Q6K7G9
LinkDB
Position
2:32961949..32963973
AA seq 501 aa
MKPRSSRDGHNAAAAAALLLAALVLSGDVLPAVVAGGAPSFNYKDALTKSIMFLEAQRSG
KLPPTNRIKWRGDSGMEDGKLANVDLTGGYYDAGDNVKYGLPLAFTVTTLAWTAMAFEKE
LKAARELENVHAAIRWGTDYFLKAATKKDHLWVQVGDPNADHQCWVRPENMPTPRTLYQI
NDKTPGSEIAAETAAAMTASSMVFRKDKPYSRRLLNKAKLLFQFAKTHQGTYDGECPFYC
SYSGYNDELLWAATWLYLATKRQVYADFIGHEAISSSVAEFSWDLKFPGAQVLLAELNMT
SSGGLQSFKSQADNFVCAVLPDTPFHQVSITPGGMIHLRDGANSQYVTSTAFLFVAYSDI
LRRINQPVMCGAQAVQPARLLQFAKQQIDYLLGANPRGRSYVVGFGVNPPTQPHHRGAST
PVLPPGYQVNCGMSFSEWFTPDRPNPNELTGAIMGGPDGGDNFSDKRGNSSCTEPCTYIN
SLSIGPLAALAIRGPNLIATQ
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaagccccgctcctcgcgcgacggccataatgccgccgccgccgccgcgctcctcctc
gcggcgctggtcctctccggcgacgtcctgccggcggtcgtggccggtggcgccccctcg
ttcaactacaaggacgcgctcaccaagtccatcatgttcctcgaggcgcagcgctccggc
aagctgccgcccaccaaccgcatcaagtggcgcggcgactccggcatggaagacggcaag
ctcgccaacgtggacctgactggcgggtactacgacgccggcgacaacgtgaagtacggg
ctgccgctggcgttcacggtgacgacgctggcgtggacggcgatggcgttcgagaaggag
ctgaaggcggcgagggagctggagaacgtgcacgcggccatcaggtggggcaccgactac
ttcctcaaggcggcgaccaagaaggaccacctgtgggtgcaggtcggcgaccccaacgcc
gaccaccagtgctgggtccgcccggagaacatgcccacgccccgcaccctctaccagatc
aacgacaagacccccggctccgagattgccgccgagaccgccgccgccatgaccgcctcc
tccatggtcttccgcaaggataagccctactcccgccgcctcctcaacaaggccaagctg
ctgttccagttcgccaagacgcaccagggaacctacgacggcgagtgccccttctactgc
tcctactccggctacaacgatgagttgctgtgggcggcgacgtggctgtacctggcgacg
aagaggcaggtgtacgcggacttcatcgggcacgaggcgatctcgtcgagcgtggccgag
ttcagctgggacctcaagttcccgggcgcgcaggtgctcctcgcggagctcaacatgaca
tccagcggcggcctccagagcttcaagtcccaggccgacaacttcgtgtgcgccgtgctc
ccggacaccccgttccaccaggtgtccatcaccccgggcggcatgatccacctccgcgac
ggcgccaactcccagtacgtcaccagcacggccttcctcttcgtcgcctacagcgacatc
ctccgccggatcaaccagccggtgatgtgcggcgcccaggccgtgcagcccgcccgcctc
ctccagttcgccaagcagcagatcgactacctcctcggcgccaacccgcgcggccgctcc
tacgtcgtcggcttcggcgtcaacccgcccacgcagccgcaccaccgcggcgcctccacc
ccggtgctccccccgggctaccaggtcaactgcgggatgagcttcagcgagtggttcacc
cccgaccggcccaaccccaacgagctcaccggcgcgatcatgggcggccccgacggcggc
gacaacttctccgacaagcgtggcaactcgtcctgcaccgagccttgcacgtacatcaac
tccctctccattggccccctcgccgccctcgccatccgtggcccaaacctcatcgccacc
cagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332724
Entry
4332724           CDS       T01015                                 
Name
(RefSeq) endoglucanase 9
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4332724
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4332724
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4332724
NCBI-ProteinID: XP_015627869
UniProt: P0C1U4
LinkDB
Position
3:complement(12104083..12108441)
AA seq 619 aa
MSMYGRDPWGGPLEICHDSATDDDRSRNLDLDRGALSRTLDETQQSWLLAGPGDQGRKKK
KYVDLGCLVVSRKLFVWTVGVLLAAAVFAGLVAGIAKAIPRHHRPPPPPDDFTVALRKAL
MFFNAQKSGKLPKNNNVHWRGNSCMKDGLSDPAVGRSLVGGYYDAGDAVKFNFPAAFSMT
LLSWSVIEYSAKYEAVGELGHIRDTIKWGADYFLKTFNSTADTIDRVVMQVGSGATSPGS
TQPNDHYCWMRPEDIDYPRPVVECHACSDLAAEMAASLAAASIVFKDNKAYSQKLVHGAT
TLFKFARQNRGRYSAGGSDAAKFYNSTSYWDEFVWGGSWMYLATGNSSYLQLATHPKLAK
HAGAYWGGPDYGVFSWDNKLTGAQVLLSRLRLFLSPGYPYEEILRTFHNQTSIIMCSYLP
IFKSFNRTKGGLIQLNHGRPQPLQYVVNAAFLASLYGDYLEAADTPGWYCGPHFYPIETL
RNFARTQIEYILGKNPLKMSYVVGYGNRYPKRVHHRGASIPKNGVHYGCKGGWKWRETKK
PNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGEGHGVDKNTMF
SAVPPMFPSPPPPPAPWKP
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgagcatgtacgggagggacccgtggggcgggccgctggagatatgccacgactcggcg
acggacgacgaccggagccggaacctggacctggacaggggggcgctgtcgcggacgctg
gacgagacgcagcagagctggctgctggccgggccgggggaccagggccggaagaagaag
aagtacgtcgacctcggctgcctcgtcgtcagccgcaagctcttcgtgtggacggtcggg
gtgctcctcgccgccgccgtcttcgccgggctcgtcgccggcatcgccaaggccatcccc
aggcaccaccgcccgccgccgccgccggacgacttcaccgtcgcgctgcgcaaggcgctc
atgttcttcaatgcccagaaatctggaaagcttccgaagaacaacaatgtgcattggcgt
ggtaactcgtgcatgaaggacggactctcggatccggcagtcgggcgcagcctcgtcgga
gggtactacgacgccggcgacgccgtcaagttcaactttccagctgccttctccatgacc
ctcctcagctggagcgtcatcgagtacagtgctaaatacgaggcagttggggaacttggc
catatccgtgataccatcaagtggggggccgattacttcttgaagaccttcaactcaacg
gcggataccattgatcgtgtcgttatgcaggtggggagcggtgcaacatcacccggttcg
actcaaccgaacgatcactattgttggatgagaccagaggacattgactaccctcgccca
gtagttgagtgccatgcttgttcagatcttgcggctgagatggctgcatcattggcagca
gcatcaattgtgttcaaggacaataaggcgtactcgcagaagctggtacatggtgctacc
accctcttcaagtttgcaaggcaaaaccgtggaagatatagtgcaggtggttccgatgct
gcaaaattctataactcaaccagctactgggatgagtttgtatggggtggttcatggatg
tatctcgcaaccggcaattcatcgtacctgcagttggcaacacaccccaagcttgcaaag
catgctggtgcttactggggtggtccagactacggtgtattcagctgggacaataagctt
actggtgcacaggttcttttgagccggttaaggctcttcttaagtcctggttatccatat
gaagagatcctcaggacattccacaatcaaacaagcattattatgtgctcttatcttcca
attttcaagtctttcaacaggacaaaaggtggtttgatccagttgaatcacgggaggcca
caacctcttcagtatgtggtgaacgctgcattccttgcttctttgtacggtgactatctt
gaggctgcagatacccctggctggtattgtgggccccatttctacccaattgaaactctg
cgcaattttgcaagaactcaaatcgaatacatcttaggaaaaaatcctttgaagatgagc
tatgtggttggttacggaaaccgttaccctaaacgtgttcatcatcggggtgcctcgatc
ccaaagaatggtgtccactacggttgcaaaggaggttggaagtggagagaaaccaagaaa
ccaaaccctaacatcatcgtcggagcgatggtagctggccctgatcgccacgacggcttc
aaggatgttcgcaagaattacaactacacggaagcaactctagctggcaatgccggtcta
gttgcagcattagtagcattgtcaggtgaaggccatggcgtggataagaacactatgttt
tctgccgtgccgccgatgttcccttcgcccccaccgcctccggcaccatggaaaccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334029
Entry
4334029           CDS       T01015                                 
Name
(RefSeq) endoglucanase 10
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4334029
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4334029
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4334029
NCBI-ProteinID: XP_015630455
UniProt: Q84R49
LinkDB
Position
3:complement(30181667..30185065)
AA seq 620 aa
MFGRDPWGGPLEISNADSATDDDRSRDLDRGALMRQLDETQQSWLLAGPGDQAGKKKKKY
VDLGCMVLDRKIFMWTVGTILGVGLFIGFVMMIVKLVPHKRPPPPPPDQYTQALHKALMF
FNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRKSLVGGFYDAGDAIKFNYPMAWSMTML
SWSVIEYKAKYEAIGELDHVKELIKWGTDYLLKTFNSSADTIDRIVAQVGVGDTSKGGAQ
PNDHYCWMRPEDIDYPRPVTECHSCSDLASEMAAALAAASIVFKDSKTYSDKLVRGAKAL
YKFGRLQRGRYSPNGSDQAIFYNSTSYWDEFVWGGAWMYFATGNNTYLSVATAPGMAKHA
GAYWLDSPNYGVFTWDDKLPGAQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPM
YNSFNFTKGGMIQLNHGRPQPLQYVVNAAFLASLYSDYLDAADTPGWYCGPTFYTTEVLR
KFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKP
NPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKNTI
FSAVPPMFPTPPPPPSAWKP
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgttcgggcgggacccgtggggcgggccgctggagatctcgaatgcggactcggcgacg
gacgacgaccggagccgggacctggacaggggggcgctgatgcggcagctggacgagacg
cagcagagctggctcctggccgggccgggcgaccaggccggcaagaagaagaagaagtac
gtcgacctcggctgcatggtcctcgaccgcaagatcttcatgtggaccgtcggcaccatc
ctcggcgtcggcctcttcatcggcttcgtcatgatgatcgtcaagctcgtcccccacaag
cgcccccctcctcctccccccgaccagtacacccaggccctccacaaggccctcatgttc
ttcaacgcgcaacgatctggtccgctgccgaagcataacggcgtcagctggagggggaat
tcttgcatgaaggatggcctctccgacagcaccgtccggaagagcttggtcggaggcttc
tacgacgcaggagacgccatcaagttcaactaccccatggcctggtccatgaccatgctc
agctggagtgtgatcgagtacaaggccaagtatgaggcgatcggtgagctcgaccatgtc
aaggagctgatcaagtggggcacagattacctcctcaagaccttcaattcatcagccgat
actatcgatcggatcgtcgcacaggtgggtgtaggtgacacctcaaaaggtggtgcccaa
cctaatgaccactactgctggatgaggccagaggatatcgattaccccagacctgtcact
gagtgccactcttgctcagatcttgcttccgaaatggctgctgcccttgctgcagcttcc
atagtgttcaaggacagcaagacttactctgacaagctcgtgcgtggcgcaaaggccctg
tacaagttcggtaggctgcagcgtgggagatacagccccaatggctctgatcaagcaatt
ttctacaattccaccagttactgggatgagtttgtgtggggtggtgcgtggatgtacttt
gccacagggaacaatacatacctatcggttgcaacagctccggggatggcaaagcatgct
ggagcatactggctcgatagtccgaattatggagtttttacctgggatgacaagcttcca
ggagctcaggttcttctgagcaggttgcggcttttcctaagtcctggatatccttacgaa
gaaatactgagaacatttcacaaccaaacagacaatgttatgtgctcgtatctgccgatg
tacaattcattcaactttaccaaaggaggaatgatacagctcaaccacggaaggcctcag
ccacttcagtatgttgtcaatgcggctttccttgcctctctatacagcgattacctggat
gctgcagatacacctgggtggtattgtggacctactttctacactacagaagtcctccgc
aaatttgcaaggtcacagctcgattatgtcctaggtaagaacccactgaagatgagctac
gttgtgggttttggaaacaagtaccccaagcgcgctcatcacagaggtgcatcaatccct
cataatggtgtcaaatatggatgcaaaggaggctttaaatggagggagactaagaagcca
aatcctaatatccttattggagcactggttgctggccctgataggcatgatggcttcaaa
gatgtccgtacaaactacaattacacggagcctactcttgcagcaaatgctggcctggtg
gcagccttgatttccctaactaacattcacgtcaaaagtggaatcgataagaacaccatc
ttctctgcagttcctccgatgtttccaactcccccacctccaccgtcagcttggaaacca
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335944
Entry
4335944           CDS       T01015                                 
Name
(RefSeq) endoglucanase 11
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4335944
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4335944
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4335944
NCBI-ProteinID: XP_015635090
LinkDB
Position
4:complement(22081672..22084325)
AA seq 510 aa
MMVSCSRMMIMSPSSSSSSWRALVLVAAAVLSFSGHVVVAAAAAGHPDYADALAKSILFF
QGQRSGRLPPDQAVKWRSNSGLSDGSAANVDLTGGYYDGGDNVKFGFPMAFTTTMLSWGV
VEYGGRMRGRVLRDARDAVRWAADYLLRAATATPGVLYVGVGDPDADHRCWERPEDMDTP
RAVYSVSASSPGSDVAAETAAALAAASLALRAADPGYSRRLLAAARDVMAFAVRHQGKYS
DHVGGDVGAYYASYSGYQDELLWGSAWLLWATRNASYLDYLASLGANDGVDMFSWDNKLA
GARVLLSRRALVNGDRRLDAFRRLAEDFICRILPGSPSSTTQYTPGGMMYKSGHANLQYV
TSASFLLTTFAKYMAVSNHTFSCQSLPVTAKTLRALARKQVDYILGANPQGMSYMVGYGA
RFPQRIHHRGASMPSVAAYPAHIGCQEGFSGYFNAGGANPNVHTGAVVGGPDQHDAFPDE
RGDYDRSEPTTYTNAALVGCLAYFAGSYRS
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgatggtgagctgctcgaggatgatgataatgtcgccgtcgtcgtcatcatcatcatgg
cgggctctcgtgcttgtcgccgccgccgtcttgtcattctccggccatgtcgtcgtcgcc
gccgccgccgccggacaccctgattacgccgacgcgctcgccaagtcgattctcttcttc
caagggcagaggtccggccgccttccgccggaccaggccgtcaagtggaggtccaactcc
ggcctctccgacggttcggcggcgaacgttgacctcaccggcggctactacgacggcggc
gacaacgtcaagttcgggttcccgatggcgttcacgacgacgatgctgtcgtggggcgtc
gtggagtacggcgggcggatgcgggggcgcgtactccgcgacgcgcgcgacgcggtgcgg
tgggcggcggactacctcctcagggcggcgacggcgaccccgggtgtgctctacgtcggc
gtcggcgaccccgacgccgaccaccggtgctgggagcggccggaggacatggacacgccg
cgggccgtgtactcggtgtcggcgtcgagccccgggtcggacgtggccgccgagaccgcg
gcggcgctcgccgccgcgtcgctggcgctcagggccgccgacccggggtactcccggagg
ctgctcgcggcggcgagggacgtcatggcgttcgccgtgcggcaccaggggaagtacagc
gaccacgttggcggcgacgtgggcgcctactacgcctcctactccggctaccaggacgag
ctcctgtgggggtccgcgtggcttctctgggcgacgaggaacgcctcctacctcgactac
ctcgcctccctcggcgccaacgacggcgtcgacatgttcagctgggacaacaagctcgcc
ggagcgcgcgtcctcctgtcgcggagggcgctggtgaatggcgatcggaggctggacgcg
ttccggcggctggcggaggacttcatctgtaggatcctgccggggtcgccgtcgtcgacg
acgcagtacacgcccggcgggatgatgtacaagtccggtcacgccaacctgcagtacgtc
acctcggccagcttcctcctcaccacgttcgccaagtacatggccgtctccaaccacacc
ttctcctgccagagcctccctgtcaccgccaagaccctccgagctctcgccaggaaacag
gtggactacatcctgggcgcgaacccgcaggggatgtcgtacatggtgggctacggcgcg
cggttcccgcagaggatacaccacaggggggcgtcgatgccgtcggtggcggcgtacccg
gcgcacatcggctgccaggaagggttcagcggctacttcaacgccggcggcgccaacccc
aacgtccacaccggcgccgtcgtcggcgggccggaccagcacgacgcgttccctgacgag
cgcggcgactacgaccggtcggagccgacgacgtacaccaacgccgccctcgtcggctgc
ctcgcctacttcgccggcagctacaggagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336284
Entry
4336284           CDS       T01015                                 
Name
(RefSeq) endoglucanase 12
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4336284
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4336284
SSDB
Motif
Pfam: Glyco_hydro_9
Other DBs
NCBI-GeneID: 4336284
NCBI-ProteinID: XP_015636553
UniProt: Q7XUK4 G5END7
LinkDB
Position
4:complement(24864002..24867834)
AA seq 623 aa
MYSANHWGGSFEIAADGAAEDDHSRNMDLDRGALSARQHQLDETQQSWLLGPPEAKKKDK
YVDLGCVVVKRKLLWWVLWTLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKALL
FFNAQKSGRLPKNNGIKWRGNSGLSDGSDLTDVKGGLVGGYYDAGDNIKFHFPLAFSMTM
LSWSVIEYSAKYKAVGEYDHVRELIKWGTDYLLLTFNSSASTIDKVYSQVGIAKINGTQP
DDHYCWNRPEDMAYPRPVQTAGSAPDLGGEMAAALAAASIVFRDNAAYSKKLVNGAAAVY
KFARSSGRRTPYSRGNQYIEYYYNSTSYWDEYMWSAAWMYYATGNNTYITFATDPRLPKN
AKAFYSILDFSVFSWDNKLPGAELLLSRLRMFLNPGYPYEESLIGYHNTTSMNMCTYFPR
FGAFNFTKGGLAQFNHGKGQPLQYTVANSFLAALYADYMESVNVPGWYCGPYFMTVDDLR
SFARSQVNYILGDNPKKMSYVVGYGKKYPRRLHHRGASTPHNGIKYSCTGGYKWRDTKGA
DPNVLVGAMVGGPDKNDQFKDARLTYAQNEPTLVGNAGLVAALVALTNSGRGAGVTAVDK
NTMFSAVPPMFPATPPPPSKWKP
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgtactcggcgaaccactggggcgggtcgttcgagatcgccgcggacggcgcggcggag
gatgaccacagccgcaacatggacctggaccgcggcgcgctgtcggcgcggcagcaccag
ctggacgagacgcagcagagctggctgctcggcccgccggaggccaagaagaaggacaag
tacgtcgacctcggctgcgtcgtcgtcaagcgcaagctcctctggtgggtcctctggacc
ctcctcgccgccttcatcctcatcggcctccccgtcatcatcgccaagtccatccccaag
aagaagccccacgcccctccccccgaccagtacaccgacgccctccacaaggccctcctc
ttcttcaacgcccagaaatccggccggctcccgaagaacaacggcatcaaatggcgcggc
aactccggcctgtcggatggctccgatctgacggacgtcaagggcgggctcgtcggcggc
tactacgacgccggcgacaacatcaagttccatttccccttggccttctccatgacaatg
ctcagctggtcagtgatcgagtacagcgccaagtacaaggcggtaggggagtatgaccat
gtgagggagctcatcaagtggggcaccgactacctgctcctcaccttcaactcctctgct
tccaccattgacaaagtctatagccaggtgggcattgcgaagatcaacggcacccagccg
gacgaccactactgctggaaccggccggaggacatggcgtacccacgccccgtccagacg
gccggctcggcgccggacctcggcggcgagatggcggcggcgctcgcggcggcctccatc
gtgttccgcgacaacgccgcctactccaagaagctcgtgaacggcgcggccgccgtgtac
aagttcgcgcgcagcagcggccgccgcaccccgtactcccgcggcaaccagtacatcgag
tactactacaactccaccagctactgggacgagtacatgtggagcgcggcgtggatgtac
tacgccacggggaacaacacctacatcaccttcgccaccgacccgcggctgcccaagaac
gccaaggccttctacagcatcctcgacttctccgtcttcagctgggacaacaagctgccg
ggcgccgagctgctgctgtcgcggctccgcatgttcctcaacccgggttacccctacgag
gagtcgctcatcgggtaccacaacaccaccagcatgaacatgtgcacctacttcccgcgc
ttcggcgccttcaacttcaccaagggtgggctcgcgcagttcaaccacgggaagggccag
ccgctgcagtacaccgtcgccaactccttcctcgccgcgctctacgccgactacatggag
tccgtcaacgtccccggctggtactgcggcccctacttcatgaccgtcgacgatctccgc
tccttcgccaggtctcaggtgaactacattcttggggataacccgaagaagatgagctac
gtggtggggtacggcaagaagtacccgcggcggctgcaccacaggggggcgtcgacgccg
cacaacggcatcaagtactcgtgcaccggcgggtacaagtggagggacaccaagggggcc
gacccgaacgtgctcgtcggcgccatggtcggcgggccggacaagaacgaccagttcaag
gacgcgcgcctcacctacgcgcagaacgagccgacgttggtgggcaacgccggcctcgtg
gccgccctcgtcgccctcaccaacagcggccgcggcgcgggcgtcaccgccgtcgacaag
aacaccatgttctccgccgtgccgcccatgttcccggccacgccgccgccgccgtccaag
tggaagccgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337384
Entry
4337384           CDS       T01015                                 
Name
(RefSeq) endoglucanase 13
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4337384
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     4337384
SSDB
Motif
Pfam: Glyco_hydro_9 CBM49
Other DBs
NCBI-GeneID: 4337384
NCBI-ProteinID: XP_015634039
UniProt: Q0J930
LinkDB
Position
4:complement(34450535..34454542)
AA seq 625 aa
MAATMNKTPATTFLLIPAAASLVLLLAAAASVEASAFDYAGAFDKCLLFFEAQRSGKLPD
DRLVRWRGDSALTDGFSQGVDLVGGYYDSGDHVKFGLPMAYAVTMLSWGVVEFEKEMVDG
NKLHRVLDAIRWGTNYFVKAHTQHNALWVQVGDGDSDHLCWERAEDMSTPRTAFKIDINN
PGSEVAGETAAALAAAAKAFKPYDRMYSDLLLLHSKQLFTFADTFRGKYDDSLQSAKKFY
PSASGYQDELLWAAAWLYEATGDEQYLRYVSQNAEAFGGTGWAVTEFSWDNKYAGLQVLL
SKVLFEQGGSAAGYADTLKQYQAKAEFFLCACLQKNNGHNVKMTPGGLMYVSDWSNMQYV
SSSAFLLTVYADYLAESRGTLRCPDGEVKPAEILRFARSQVDYVLGKNPKGMSYMVGYGS
YYPTHVHHRGASIPSIYAMNATVGCMESFDKYYNSKNADPNVLHGALVGGPDANDAYDDD
RCNYQHAEPTLAGNAPMSGVFARLAASPADNTPEYTPAPNAPSPSNGGSPLEFVHTVTNT
WKANGVDYYRHVVTAKNTCGHAITYLKLQIKELSGEIYGVSRTNAKDMYEFPSWMTRLDA
GAQLTIVYIQGGPAAKIAVVEYKTA
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggcggcgacgatgaacaagacgccggcaaccaccttcctgctgataccggcggcggcg
tcgctggttctcctcctcgcggcggccgcgtcggtggaggcgtcggcgttcgactacgcc
ggcgcgttcgacaagtgcctcctgttcttcgaggcgcagcgctccggcaagctccccgac
gaccgcctcgtccggtggcgcggcgactccgccctcaccgacggcttctcccagggggtg
gatttggtgggcgggtactacgactccggcgaccacgtgaagttcgggctcccgatggcg
tacgcggtgacgatgctgtcgtggggggtggtcgagttcgagaaggagatggtcgacggc
aacaagctccaccgcgtcctcgacgccatccgctggggcaccaactacttcgtcaaggcc
cacacccagcacaacgccctctgggtccaggtgggtgacggcgacagcgaccacctgtgc
tgggagcgcgccgaggacatgtcgacgccgcgcacggcgttcaagatcgacatcaacaac
cccgggtcggaggtcgccggcgagaccgccgccgctctcgccgccgccgccaaggccttc
aagccctacgaccgcatgtactccgacctcctcctcctccactccaagcagctgttcacg
ttcgcggacacgttcaggggcaagtacgacgactcgctgcagagcgccaagaagttctac
ccgtcggcgtccggctaccaggacgagctgctgtgggcggcggcgtggctgtacgaggcg
accggcgacgagcagtacctccgctacgtgtcccagaacgcggaggcgttcggcggcacc
ggctgggccgtcaccgagttctcctgggacaacaagtacgccggcctccaggtcctcctc
tccaaggtcctcttcgagcagggcggcagcgccgccggctacgccgacacgctgaagcag
tatcaggccaaggccgagttcttcctctgcgcctgcctccagaagaacaacggccacaac
gtcaagatgacccctggtggtctcatgtacgtgagcgactggagcaacatgcagtacgtg
agctcgtcggcgttcctcctcaccgtctacgccgactacctcgccgagtcgcggggaacg
ctcaggtgcccggacggcgaggtgaagccggcggagatcctccggttcgcgaggtcgcag
gtcgactacgtcctcggcaagaaccccaaggggatgagctacatggtcggatacggcagc
tactacccgacgcacgtccaccaccgcggcgcgtccatcccgtccatctacgccatgaac
gccaccgtcgggtgcatggaaagcttcgacaagtactacaacagcaagaacgccgacccc
aacgtcctccacggcgccctcgtcggcggccccgacgccaacgacgcctacgacgacgac
cgctgcaactaccagcacgccgagcccaccctcgccggcaacgcccccatgtccggcgtc
ttcgcccgcctcgccgcctcgcccgccgataacacgccggagtacacgccggcgccaaat
gccccctcgccatcaaatggtgggtcgccgttggagttcgtgcacacggtgacgaacacg
tggaaggcaaacggcgtggactactaccggcacgtggtgacggcgaagaacacgtgcggc
cacgccatcacctacctgaagctgcagatcaaggagctctccggggagatctacggcgtc
tcccgcacgaacgccaaggacatgtacgagttcccgtcgtggatgacacggctcgacgcc
ggcgcgcagctcaccatcgtctacatccagggcggccccgccgccaagatcgccgtcgtc
gagtacaagacggcctga

DBGET integrated database retrieval system