KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324645
Entry
4324645           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4324645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4324645
   03029 Mitochondrial biogenesis [BR:osa03029]
    4324645
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4324645
  Bacteria
    4324645
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4324645
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-GeneID: 4324645
NCBI-ProteinID: XP_015622102
UniProt: A0A0P0V077 Q9LWD2
LinkDB
Position
1:6583692..6587108
AA seq 146 aa
MPLYDCMLLVKPLVTREAMAELVGRVARRAYQRNGVVTDVKSFGTICLGYGIKKLDGRHF
KGQLMQMTMMVPPSFTQELHYLNKEDRLLRWLVVKHRDAVYGVEFINEDDGRREMTDFRY
RTKDEASDVDEYDDDDDDYEYEIDEE
NT seq 441 nt   +upstreamnt  +downstreamnt
atgccgctctacgactgcatgctgctggtgaagccgctggtgaccagggaggccatggcg
gagctcgtggggcgggtggcgcggcgggcgtaccagcggaacggcgtcgtcaccgacgtc
aagtccttcggcaccatctgcctcggctacggcatcaagaagctcgacggccgccacttc
aagggccaacttatgcaaatgaccatgatggttccaccctccttcacccaagaactccac
tacctgaacaaggaggacaggctgctccgctggctggtggtgaagcacagagacgcggtg
tatggtgtggagttcatcaacgaggacgacgggaggagggagatgacggacttccgctac
cgcaccaaagacgaggccagcgatgtcgatgagtatgatgacgacgatgatgactatgaa
tatgagatcgacgaggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334749
Entry
4334749           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S6 alpha, chloroplastic
  KO
K02990  small subunit ribosomal protein S6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334749
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334749
   03029 Mitochondrial biogenesis [BR:osa03029]
    4334749
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4334749
  Bacteria
    4334749
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4334749
SSDB
Motif
Pfam: Ribosomal_S6 Keratin_2_head
Other DBs
NCBI-GeneID: 4334749
NCBI-ProteinID: XP_015629708
UniProt: Q75LD8 A0A0P0W5E9
LinkDB
Position
3:35444421..35446340
AA seq 219 aa
MPPPMALSISSTAAATALLPTLPPSRSRLRVAPRRAAARVARVVSAGYAAGFYGGAAAAA
GGENDEVGDEEGSSSGFGAGLGIGGGGLGMSAAEAALALEEREMPPCPPGLRQYETMVVL
RPDMSEEERLALIQRYEELLVAGGAMYVEVFNRGVIPLAYSIRKRNSRTGLPSTYYDGIY
LLVTYFTKPESLDALQMRLNADDDVIRSTSFKVRKRKAF
NT seq 660 nt   +upstreamnt  +downstreamnt
atgccgccaccaatggcgctctccatctcctccaccgccgcggcgaccgctctcctcccg
actctcccgccctcgcgctcgcgcctgcgcgtcgcgccgcgcagggcggcggctcgggtg
gcgcgcgtggtgtcggccggatacgccgcggggttctacggcggggcggcggctgcggcc
ggtggcgagaacgacgaggtgggggatgaggagggttcgtcctcggggttcggtgctggg
ctagggataggaggcggtgggcttgggatgtcggccgcggaggcggcgctggcgctggag
gagcgggagatgccgccgtgcccgcccgggcttcgccagtacgagaccatggtcgtgctc
cgccccgacatgtccgaggaggagcgcctcgccctcatacagcgttacgaggagctcctt
gttgcgggtggcgccatgtatgtggaagtcttcaaccgaggagtcatcccactggcatac
agcatcaggaagaggaacagcaggactggtttgccatccacctactacgacggaatctac
ctccttgtgacatacttcaccaagcctgaatccctggatgctctgcaaatgaggctcaat
gctgacgacgatgtcatccgctcaaccagtttcaaggtccgcaagcggaaagccttttaa

DBGET integrated database retrieval system